SSSCA1 Antibody

Images

 
Western Blot: SSSCA1 Antibody [NBP2-13387] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: SSSCA1 Antibody [NBP2-13387] - Staining of human cell line U-251 MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: SSSCA1 Antibody [NBP2-13387] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Western Blot: SSSCA1 Antibody [NBP2-13387] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SSSCA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETC ADCGTILLQDKQRKIYCVACQELDSDVDKDNPALNAQAALSQAR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SSSCA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SSSCA1 Protein (NBP2-13387PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SSSCA1 Antibody

  • Autoantigen p27
  • centromeric autoantigen (27kD)
  • p27
  • Sjoegren syndrome/scleroderma autoantigen 1
  • Sjogren syndrome/scleroderma autoantigen 1
  • Sjogren's syndrome/scleroderma autoantigen 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1555
Species: Hu
Applications: WB
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
H00056996-R01
Species: Hu
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6817
Species: Hu
Applications: WB

Publications for SSSCA1 Antibody (NBP2-13387) (0)

There are no publications for SSSCA1 Antibody (NBP2-13387).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSSCA1 Antibody (NBP2-13387) (0)

There are no reviews for SSSCA1 Antibody (NBP2-13387). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SSSCA1 Antibody (NBP2-13387) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SSSCA1 Products

Bioinformatics Tool for SSSCA1 Antibody (NBP2-13387)

Discover related pathways, diseases and genes to SSSCA1 Antibody (NBP2-13387). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for SSSCA1 Antibody (NBP2-13387)

Find related products by research area.

Blogs on SSSCA1

There are no specific blogs for SSSCA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SSSCA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SSSCA1