SSBP1 Antibody (4C1)

Images

 
ELISA: SSBP1 Antibody (4C1) [H00006742-M10] - Detection limit for recombinant GST tagged SSBP1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
4C1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SSBP1 Antibody (4C1) Summary

Immunogen
SSBP1 (AAH00895, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE
Marker
Mitochondria Marker
Specificity
SSBP1 (4C1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SSBP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00006742-M10.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SSBP1 Antibody (4C1)

  • mitochondrial
  • MtSSB
  • single-stranded DNA binding protein 1
  • SSBP1

Background

SSBP is a housekeeping gene involved in mitochondrial biogenesis (Tiranti et al., 1995 [PubMed 7789991]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-58327
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-71648
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NBP2-92873
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-88262
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01578
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-98143
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00023648-M01
Species: Hu, Mu
Applications: WB, ELISA, S-ELISA
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-19091
Species: Hu, Mu
Applications: WB, IP
NB100-104
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD
NBP1-52300
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
H00023635-B01P
Species: Hu
Applications: WB, ICC/IF
MAB6534
Species: Hu
Applications: WB, ELISA
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
H00006742-M10
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for SSBP1 Antibody (H00006742-M10)(1)

Reviews for SSBP1 Antibody (H00006742-M10) (0)

There are no reviews for SSBP1 Antibody (H00006742-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SSBP1 Antibody (H00006742-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SSBP1 Products

Bioinformatics Tool for SSBP1 Antibody (H00006742-M10)

Discover related pathways, diseases and genes to SSBP1 Antibody (H00006742-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSBP1 Antibody (H00006742-M10)

Discover more about diseases related to SSBP1 Antibody (H00006742-M10).
 

Pathways for SSBP1 Antibody (H00006742-M10)

View related products by pathway.

PTMs for SSBP1 Antibody (H00006742-M10)

Learn more about PTMs related to SSBP1 Antibody (H00006742-M10).
 

Research Areas for SSBP1 Antibody (H00006742-M10)

Find related products by research area.

Blogs on SSBP1

There are no specific blogs for SSBP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SSBP1 Antibody (4C1) and receive a gift card or discount.

Bioinformatics

Gene Symbol SSBP1
Entrez
OMIM
Uniprot