SS18 Antibody


Immunocytochemistry/ Immunofluorescence: SS18 Antibody [NBP2-31777] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SS18 Antibody [NBP2-31777] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

SS18 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: NGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMP
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SS18 Protein (NBP2-31777PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SS18 Antibody

  • MGC116875
  • Protein SYT
  • SSXTsynovial sarcoma, translocated to X chromosome
  • Synovial sarcoma translocated to X chromosome protein
  • synovial sarcoma translocation, chromosome 18
  • SYTprotein SSXT


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC-P, IP, PLA
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for SS18 Antibody (NBP2-31777) (0)

There are no publications for SS18 Antibody (NBP2-31777).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SS18 Antibody (NBP2-31777) (0)

There are no reviews for SS18 Antibody (NBP2-31777). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SS18 Antibody (NBP2-31777) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SS18 Products

Bioinformatics Tool for SS18 Antibody (NBP2-31777)

Discover related pathways, diseases and genes to SS18 Antibody (NBP2-31777). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SS18 Antibody (NBP2-31777)

Discover more about diseases related to SS18 Antibody (NBP2-31777).

Pathways for SS18 Antibody (NBP2-31777)

View related products by pathway.

PTMs for SS18 Antibody (NBP2-31777)

Learn more about PTMs related to SS18 Antibody (NBP2-31777).

Research Areas for SS18 Antibody (NBP2-31777)

Find related products by research area.

Blogs on SS18

There are no specific blogs for SS18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SS18 Antibody and receive a gift card or discount.


Gene Symbol SS18