SRPX Antibody - BSA Free

Western Blot: SRPX Antibody [NBP2-86829] - Host: Rabbit. Target Name: Srpx. Sample Type: Mouse Muscle lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SRPX Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse SRPX. Peptide sequence: PEGRDTADGILTDVILKGLPPGSNFPEGDHKIEYTVYDRAENKGTCKFRV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SRPX
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SRPX Antibody - BSA Free

• DRS
• ETX1SRPX1
• sushi repeat-containing protein SRPX
• sushi-repeat containing protein, X-linked
• sushi-repeat-containing protein, X chromosome
• sushi-repeat-containing protein, X-linked

Background

SRPX may be involved in phagocytosis during disk shedding, cell adhesion to cells other than the pigment epithelium or signal transduction

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SRPX