SRp55 Antibody (6A10)

Images

 
Sandwich ELISA: SRp55 Antibody (6A10) [H00006431-M01] - Detection limit for recombinant GST tagged SFRS6 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SRp55 Antibody (6A10) Summary

Immunogen
SFRS6 (NP_006266, 1 a.a. - 75 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRR
Specificity
SFRS6 - splicing factor, arginine/serine-rich 6
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SRSF6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SRp55 Antibody (6A10)

  • B52
  • FLJ08061
  • pre-mRNA splicing factor SRP55
  • Pre-mRNA-splicing factor SRP55
  • serine/arginine-rich splicing factor 6
  • SFRS6
  • Splicing factor, arginine/serine-rich 6MGC5045
  • splicing factor, arginine/serine-rich, 55 kDa
  • SR splicing factor 6
  • SRP55arginine/serine-rich splicing factor 6

Background

The protein encoded by this gene is involved in mRNA splicing and may play a role in the determination of alternative splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP2-04144
Species: Hu
Applications: WB, IHC-P, IP
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for SRp55 Antibody (H00006431-M01) (0)

There are no publications for SRp55 Antibody (H00006431-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRp55 Antibody (H00006431-M01) (0)

There are no reviews for SRp55 Antibody (H00006431-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRp55 Antibody (H00006431-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRp55 Products

Bioinformatics Tool for SRp55 Antibody (H00006431-M01)

Discover related pathways, diseases and genes to SRp55 Antibody (H00006431-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRp55 Antibody (H00006431-M01)

Discover more about diseases related to SRp55 Antibody (H00006431-M01).
 

Pathways for SRp55 Antibody (H00006431-M01)

View related products by pathway.

PTMs for SRp55 Antibody (H00006431-M01)

Learn more about PTMs related to SRp55 Antibody (H00006431-M01).

Blogs on SRp55

There are no specific blogs for SRp55, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SRp55 RNAi
H00006431-R01-20nmol

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRp55 Antibody (6A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol SRSF6
Entrez
OMIM
Uniprot