SRI Antibody

Images

 
Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining of human rectum shows high expression.
Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining in human rectum and skeletal muscle tissues using anti-SRI antibody. Corresponding SRI RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining of human cerebral cortex, liver, rectum and skeletal muscle using Anti-SRI antibody NBP2-57990 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining of human liver.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SRI Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYI
Specificity
Specificity of human SR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRI
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
SRI Knockout HeLa Cell Lysate
Control Peptide
SRI Recombinant Protein Antigen (NBP2-57990PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SRI Antibody

  • calcium binding protein amplified in mutlidrug-resistant cells
  • CP22
  • CP-22
  • FLJ26259,22 kDa protein
  • H_RG167B05.1
  • SCN
  • sorcin
  • V19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-31209
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF3926
Species: Hu, Mu, Rt
Applications: WB
NBP1-86125
Species: Hu
Applications: IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-13296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IM, IP
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-20194
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67691
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-76961
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ma, Fi, Ma-Mn, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N

Publications for SRI Antibody (NBP2-57990) (0)

There are no publications for SRI Antibody (NBP2-57990).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRI Antibody (NBP2-57990) (0)

There are no reviews for SRI Antibody (NBP2-57990). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SRI Antibody (NBP2-57990) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SRI Products

Bioinformatics Tool for SRI Antibody (NBP2-57990)

Discover related pathways, diseases and genes to SRI Antibody (NBP2-57990). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRI Antibody (NBP2-57990)

Discover more about diseases related to SRI Antibody (NBP2-57990).
 

Pathways for SRI Antibody (NBP2-57990)

View related products by pathway.

PTMs for SRI Antibody (NBP2-57990)

Learn more about PTMs related to SRI Antibody (NBP2-57990).

Blogs on SRI

There are no specific blogs for SRI, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRI