![Western Blot: Spt6 Antibody [NBP2-93722] - Analysis of extracts of various cell lines, using Spt6 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 10s.](http://images.novusbio.com/fullsize/Spt6-Antibody-Western-Blot-NBP2-93722-img0002.jpg "Western Blot: Spt6 Antibody [NBP2-93722] - Analysis of extracts of various cell lines, using Spt6 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1500-1726 of human SUPT6H (NP_003161.2). IFPTVNGLFRWFKDHYQDPVPGITPSSSSRTRTPASINATPANINLADLTRAVNALPQNMTSQMFSAIAAVTGQGQNPNATPAQWASSQYGYGGSGGGSSAYHVFPTPAQQPVATPLMTPSYSYTTPSQPITTPQYHQLQASTTPQSAQAQPQPSSSSRQRQQQPKSNSHAAIDWGKMAEQWLQEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SUPT6H |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Spt6 Antibody (NBP2-93722)Find related products by research area.
|
|
Breast cancer stem cells survive chemotherapy through S100A10-ANXA2-SPT6 interaction that epigenetically promotes OCT4-mediated stemness By Jamshed Arslan, Pharm D, PhDBreast cancer is the most common cancer among women that causes the greatest number of cancer-related deaths worldwide. After radiotherapy or cytotoxic chemotherapy like paclitax... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SUPT6H |
![Immunocytochemistry/Immunofluorescence: Spt6 Antibody [NBP2-93722] - Analysis of U-2 OS cells using Spt6 at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Spt6-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93722-img0001.jpg "Immunocytochemistry/Immunofluorescence: Spt6 Antibody [NBP2-93722] - Analysis of U-2 OS cells using Spt6 at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunoprecipitation: Spt6 Antibody [NBP2-93722] - Immunoprecipitation analysis of 600ug extracts of Mouse heart using 3ug Spt6 antibody (NBP2-93722). Western blot was performed from the immunoprecipitate using Spt6 antibody (NBP2-93722) at a dilution of 1:500.](http://images.novusbio.com/fullsize/Spt6-Antibody-Immunoprecipitation-NBP2-93722-img0003.jpg "Immunoprecipitation: Spt6 Antibody [NBP2-93722] - Immunoprecipitation analysis of 600ug extracts of Mouse heart using 3ug Spt6 antibody (NBP2-93722). Western blot was performed from the immunoprecipitate using Spt6 antibody (NBP2-93722) at a dilution of 1:500.")
![Western Blot Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Western_Blot_5829.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11663.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11664.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")