SPRR3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SPRR3 Antibody [NBP3-35206] - Immunofluorescence analysis of C6 cells using SPRR3 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: SPRR3 Antibody [NBP3-35206] - Western blot analysis of various lysates using SPRR3 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Immunocytochemistry/ Immunofluorescence: SPRR3 Antibody [NBP3-35206] - Immunofluorescence analysis of U2OS cells using SPRR3 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: SPRR3 Antibody [NBP3-35206] - Immunofluorescence analysis of L929 cells using SPRR3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SPRR3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SPRR3 Antibody - BSA Free (NBP3-35206) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human SPRR3 (NP_005407.1).
  
  Sequence:
  MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPRR3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SPRR3 Antibody - BSA Free

• 22 kDa pancornulin
• Cornifin beta
• esophagin
• small proline-rich protein 3
• SPRC

Background

SPRR3, also known as Small proline-rich protein 3, consists of a 169 amino acid isoform that is 18 kDa, and is involved in the surrounding and protection of keratinocytes. Disease research on the protein is currently being conducted with ichthyosis vulgaris, psoriasis, eosinophilic esophagitis, verrucous carcinoma, periodontitis, esophageal cancer, eczema, tonsillitis, and skin disease. SPRR3 is linked to several biological processes, including epidermis development, wound healing, and keratinocyte differentiation, in which it interacts with other proteins, such as IVL, EVPL, NFKBIA, and LOR.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPRR3