Recombinant Human SPRR1B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SPRR1B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 32509 of Human SPRR1B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSSQQQKQPCIPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SPRR1B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPRR1B Protein

  • 14.9 kDa pancornulin
  • cornifin B
  • CORNIFIN
  • cornifin-B
  • GADD33
  • MGC61901
  • small proline-rich protein 1B
  • Small proline-rich protein IB
  • SPR-IB
  • SPRR1

Background

SPRR1B( AAH56240, 1 a.a. - 90 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-33610
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
H00006707-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2848
Species: Hu, Mu
Applications: WB, ICC
NB100-56530
Species: Hu
Applications: WB
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6184
Species: Mu
Applications: WB, CyTOF-ready, ICFlow
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45955
Species: Hu
Applications: WB
NBP1-80687
Species: Hu
Applications: IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006699-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SPRR1B Recombinant Protein (H00006699-P01) (0)

There are no publications for SPRR1B Recombinant Protein (H00006699-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPRR1B Recombinant Protein (H00006699-P01) (0)

There are no reviews for SPRR1B Recombinant Protein (H00006699-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPRR1B Recombinant Protein (H00006699-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPRR1B Products

SPRR1B H00006699-P01

Bioinformatics Tool for SPRR1B Recombinant Protein (H00006699-P01)

Discover related pathways, diseases and genes to SPRR1B Recombinant Protein (H00006699-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPRR1B Recombinant Protein (H00006699-P01)

Discover more about diseases related to SPRR1B Recombinant Protein (H00006699-P01).
 

Pathways for SPRR1B Recombinant Protein (H00006699-P01)

View related products by pathway.

Blogs on SPRR1B

There are no specific blogs for SPRR1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD4 Antibody
NBP1-19371

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPRR1B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPRR1B