SPRR3 Antibody - BSA Free

Immunohistochemistry-Paraffin: SPRR3 Antibody [NBP2-13374] - Analysis in human esophagus and liver tissues using NBP2-13374 antibody. Corresponding SPRR3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SPRR3 Antibody [NBP2-13374] - Staining of human uterine cervix shows moderate cytoplasmic and nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: SPRR3 Antibody [NBP2-13374] - Staining of human esophagus shows moderate cytoplasmic and nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: SPRR3 Antibody [NBP2-13374] - Staining of human tonsil shows moderate to strong cytoplasmic and nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: SPRR3 Antibody [NBP2-13374] - Staining of human liver shows no positivity in hepatocytes as expected.

Analysis in human esophagus and liver tissues using NBP2-13374 antibody. Corresponding SPRR3 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SPRR3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: EPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPRR3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SPRR3 Protein (NBP2-13374PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SPRR3 Antibody - BSA Free

• 22 kDa pancornulin
• Cornifin beta
• esophagin
• small proline-rich protein 3
• SPRC

Background

SPRR3, also known as Small proline-rich protein 3, consists of a 169 amino acid isoform that is 18 kDa, and is involved in the surrounding and protection of keratinocytes. Disease research on the protein is currently being conducted with ichthyosis vulgaris, psoriasis, eosinophilic esophagitis, verrucous carcinoma, periodontitis, esophageal cancer, eczema, tonsillitis, and skin disease. SPRR3 is linked to several biological processes, including epidermis development, wound healing, and keratinocyte differentiation, in which it interacts with other proteins, such as IVL, EVPL, NFKBIA, and LOR.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SPRR3 Antibody (NBP2-13374)(1)

Publication using NBP2-13374

• Oppel F, Gendreizig S, Martinez-Ruiz L et al. Head and neck cancer cells terminally differentiate reflecting their tissue of origin: a rationale for differentiation therapies bioRxiv 2023-07-04 (IHC, ICC/IF, Human)

Review for SPRR3 Antibody (NBP2-13374) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Felix Oppel Indirect Immunofluorescence Human 05/03/2022

Summary

• Application: Other
• Sample Tested: Cell culture
• Species: Human
• Lot: 000013597

Bioinformatics

• Gene Symbol: SPRR3