SPRR3 Antibody

Images

 
Immunohistochemistry-Paraffin: SPRR3 Antibody [NBP2-13374] Staining of human oral mucosa shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPRR3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEP GCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPRR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPRR3 Protein (NBP2-13374PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPRR3 Antibody

  • 22 kDa pancornulin
  • Cornifin beta
  • esophagin
  • small proline-rich protein 3
  • SPRC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33610
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
H00006699-P01
Species: Hu
NBP1-87528
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03256
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82137
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13374
Species: Hu
Applications: IHC, IHC-P

Publications for SPRR3 Antibody (NBP2-13374) (0)

There are no publications for SPRR3 Antibody (NBP2-13374).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPRR3 Antibody (NBP2-13374) (0)

There are no reviews for SPRR3 Antibody (NBP2-13374). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPRR3 Antibody (NBP2-13374) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPRR3 Products

Bioinformatics Tool for SPRR3 Antibody (NBP2-13374)

Discover related pathways, diseases and genes to SPRR3 Antibody (NBP2-13374). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPRR3 Antibody (NBP2-13374)

Discover more about diseases related to SPRR3 Antibody (NBP2-13374).
 

Pathways for SPRR3 Antibody (NBP2-13374)

View related products by pathway.

PTMs for SPRR3 Antibody (NBP2-13374)

Learn more about PTMs related to SPRR3 Antibody (NBP2-13374).
 

Research Areas for SPRR3 Antibody (NBP2-13374)

Find related products by research area.

Blogs on SPRR3

There are no specific blogs for SPRR3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPRR3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPRR3