| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: EPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SPRR3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-13374 | Applications | Species |
|---|---|---|
| Oppel F, Gendreizig S, Martinez-Ruiz L et al. Head and neck cancer cells terminally differentiate reflecting their tissue of origin: a rationale for differentiation therapies bioRxiv 2023-07-04 (IHC, ICC/IF, Human) | IHC, ICC/IF | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Felix Oppel |
Indirect Immunofluorescence | Human | 05/03/2022 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for SPRR3 Antibody (NBP2-13374)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Felix Oppel 05/03/2022 |
||
| Application: | Indirect Immunofluorescence | |
| Species: | Human |
| Gene Symbol | SPRR3 |