SPP2 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: FPVYDYDPSSLRDALSASVVKVNSQSLSPYLF |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SPP2 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:50-1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for SPP2 Antibody
Background
Sphingosine 1 phosphate phosphotase 2 is a highly bioactive lipid that has a myriad of biological effects both intracellularly as a second messenger and extracellularly by binding to the S1P(1-5)/G protein-coupled receptors of the endothelial differentiation gene family. Intracellularly, at least two enzymes, sphingosine kinase (1 and 2) and S1P phosphatase, regulate the activity of S1P by governing the phosphorylation of S1P. SPPase2 is localized to the endoplasmic reticulum. The enzymatic activity and localization of SPPase2 are similar to SPPase1. The tissue expression of SPPase2 was different from that of SPPase1. SPPase2 is an important member of the SPPase family which play a role in attenuating intracellular S1P signaling.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Publications for SPP2 Antibody (NBP2-13373) (0)
There are no publications for SPP2 Antibody (NBP2-13373).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SPP2 Antibody (NBP2-13373) (0)
There are no reviews for SPP2 Antibody (NBP2-13373).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for SPP2 Antibody (NBP2-13373) (0)
Secondary Antibodies
| |
Isotype Controls
|
Blogs on SPP2