SPP2 Antibody

Product Discontinued

SPP2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FPVYDYDPSSLRDALSASVVKVNSQSLSPYLF
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SPP2 Antibody

• secreted phosphoprotein 2, 24kDa

Background

Sphingosine 1 phosphate phosphotase 2 is a highly bioactive lipid that has a myriad of biological effects both intracellularly as a second messenger and extracellularly by binding to the S1P(1-5)/G protein-coupled receptors of the endothelial differentiation gene family. Intracellularly, at least two enzymes, sphingosine kinase (1 and 2) and S1P phosphatase, regulate the activity of S1P by governing the phosphorylation of S1P. SPPase2 is localized to the endoplasmic reticulum. The enzymatic activity and localization of SPPase2 are similar to SPPase1. The tissue expression of SPPase2 was different from that of SPPase1. SPPase2 is an important member of the SPPase family which play a role in attenuating intracellular S1P signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPP2