Splicing factor, arginine/serine-rich 11 Antibody - BSA Free

Immunohistochemistry: Splicing factor, arginine/serine-rich 11 Antibody [NBP3-35832] - Immunohistochemistry analysis of paraffin-embedded Human breast using Splicing factor, arginine/serine-rich 11 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: Splicing factor, arginine/serine-rich 11 Antibody [NBP3-35832] - Western blot analysis of lysates from Rat lung, using Splicing factor, arginine/serine-rich 11 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Splicing factor, arginine/serine-rich 11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Splicing factor, arginine/serine-rich 11 Antibody - BSA Free (NBP3-35832) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 396-483 of human Splicing factor, arginine/serine-rich 11 (NP_001177916).
  
  Sequence:
  SKKKKSKDKEKDRERKSESDKDVKVTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMDMSD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SRSF11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 54 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Splicing factor, arginine/serine-rich 11 Antibody - BSA Free

• Arginine-rich 54 kDa nuclear protein
• dJ677H15.2
• DKFZp686M13204
• p54NET2
• serine/arginine-rich splicing factor 11
• SFRS11
• splicing factor p54
• Splicing factor, arginine/serine-rich 11FLJ18226
• SR splicing factor 11

Background

The Splicing factor, arginine/serine-rich 11 gene encodes 54-kD nuclear protein that contains an arginine/serine-rich region similar to segments found in pre-mRNA splicing factors. Although the function of this protein is not yet known, structure and immunolocalization data suggest that it may

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SRSF11