Recombinant Human SPINK2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SPINK2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 30682 of Human SPINK2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SPINK2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPINK2 Protein

  • Acrosin-trypsin inhibitor
  • Kazal type 2 (acrosin-trypsin inhibitor)
  • serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor)
  • serine protease inhibitor Kazal-type 2
  • serine protease inhibitor, Kazal type, 2 (acrosin-trypsin inhibitor)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-13371
Species: Hu
Applications: IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF5525
Species: Hu
Applications: WB, IHC
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF5510
Species: Hu
Applications: WB
MAB5809
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-48700
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SPINK2 Recombinant Protein (H00006691-P01) (0)

There are no publications for SPINK2 Recombinant Protein (H00006691-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPINK2 Recombinant Protein (H00006691-P01) (0)

There are no reviews for SPINK2 Recombinant Protein (H00006691-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPINK2 Recombinant Protein (H00006691-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPINK2 Products

Bioinformatics Tool for SPINK2 Recombinant Protein (H00006691-P01)

Discover related pathways, diseases and genes to SPINK2 Recombinant Protein (H00006691-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPINK2 Recombinant Protein (H00006691-P01)

Discover more about diseases related to SPINK2 Recombinant Protein (H00006691-P01).
 

Pathways for SPINK2 Recombinant Protein (H00006691-P01)

View related products by pathway.

PTMs for SPINK2 Recombinant Protein (H00006691-P01)

Learn more about PTMs related to SPINK2 Recombinant Protein (H00006691-P01).

Blogs on SPINK2

There are no specific blogs for SPINK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
SPINK2 Antibody
32570002-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPINK2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPINK2