SPIC Antibody

Images

 
Western Blot: SPIC Antibody [NBP1-80288] - SP2/0 cell lysate, concentration 1.25ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPIC Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of mouse SPIC. Peptide sequence MTCCIDQDSLGQTFQDAIDILIQQSAGESQYSSENRNYMAIINPYPHVRG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPIC
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against SPIon Channel and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SPIC Antibody

  • MGC40611
  • Spi-C transcription factor (Spi-1/PU.1 related)
  • SPI-C
  • transcription factor Spi-C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NBP2-37458
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-54155
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2797
Species: Hu
Applications: WB
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-80104
Species: Hu
Applications: WB
AF123
Species: Hu
Applications: WB, Block, ICC
NB100-65338
Species: Hu, Po, Ca, Pm
Applications: Flow, IHC, IHC-Fr, IP

Publications for SPIC Antibody (NBP1-80288) (0)

There are no publications for SPIC Antibody (NBP1-80288).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPIC Antibody (NBP1-80288) (0)

There are no reviews for SPIC Antibody (NBP1-80288). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPIC Antibody (NBP1-80288) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPIC Products

Bioinformatics Tool for SPIC Antibody (NBP1-80288)

Discover related pathways, diseases and genes to SPIC Antibody (NBP1-80288). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPIC Antibody (NBP1-80288)

Discover more about diseases related to SPIC Antibody (NBP1-80288).
 

Pathways for SPIC Antibody (NBP1-80288)

View related products by pathway.

PTMs for SPIC Antibody (NBP1-80288)

Learn more about PTMs related to SPIC Antibody (NBP1-80288).

Blogs on SPIC

There are no specific blogs for SPIC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPIC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPIC
Uniprot