SPG20 Antibody

Images

 
Immunohistochemistry-Paraffin: SPG20 Antibody [NBP1-82982] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPG20 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQIPGRTRPSSDQLKEASGTDVKQLDQGNKDVRHKGKRGKRAKDTSSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPG20
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPG20 Protein (NBP1-82982PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPG20 Antibody

  • KIAA0610SPARTIN
  • spastic paraplegia 20 (Troyer syndrome)
  • Spastic paraplegia 20 protein
  • TAHCCP1spartin
  • Trans-activated by hepatitis C virus core protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-68142
Species: Hu
Applications: WB, PEP-ELISA
H00011059-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NB110-40877
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB110-40764
Species: Hu, Mu, Po, Pm
Applications: WB, ICC/IF
NBP1-93476
Species: Hu
Applications: IHC, IHC-P
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-76498
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
AF7385
Species: Hu
Applications: WB, ICC
H00051062-M03
Species: Hu, Rt
Applications: WB, ELISA
NBP1-86829
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SPG20 Antibody (NBP1-82982) (0)

There are no publications for SPG20 Antibody (NBP1-82982).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPG20 Antibody (NBP1-82982) (0)

There are no reviews for SPG20 Antibody (NBP1-82982). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPG20 Antibody (NBP1-82982) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPG20 Products

Bioinformatics Tool for SPG20 Antibody (NBP1-82982)

Discover related pathways, diseases and genes to SPG20 Antibody (NBP1-82982). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPG20 Antibody (NBP1-82982)

Discover more about diseases related to SPG20 Antibody (NBP1-82982).
 

Pathways for SPG20 Antibody (NBP1-82982)

View related products by pathway.

PTMs for SPG20 Antibody (NBP1-82982)

Learn more about PTMs related to SPG20 Antibody (NBP1-82982).

Blogs on SPG20

There are no specific blogs for SPG20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPG20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPG20