Spectrin beta 3 Recombinant Protein Antigen

Images

 
There are currently no images for Spectrin beta 3 Recombinant Protein Antigen (NBP2-48703PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Spectrin beta 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Spectrin beta 3.

Source: E. coli

Amino Acid Sequence: PPPSTQAPSVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRGPAPSAMPQSRSTESAH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SPTBN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48703.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Spectrin beta 3 Recombinant Protein Antigen

  • beta-III Spectrin
  • glutamate transporter EAAT4-associated protein 41
  • GTRAP41
  • KIAA0302
  • SCA5
  • SCAR14
  • Spectrin beta 3
  • spectrin beta chain, brain 2
  • Spectrin beta III
  • spectrin, beta, non-erythrocytic 2
  • Spectrin, non-erythroid beta chain 2
  • spinocerebellar ataxia 5
  • SPTBN2

Background

Spectrins are principle components of a cell's membrane-cytoskeleton and are composed of two alpha and two beta spectrin subunits. The protein encoded by this gene (SPTBN2), is called spectrin beta non-erythrocytic 2 or beta-III spectrin. It is related to, but distinct from, the beta-II spectrin gene which is also known as spectrin beta non-erythrocytic 1 (SPTBN1). SPTBN2 regulates the glutamate signaling pathway by stabilizing the glutamate transporter EAAT4 at the surface of the plasma membrane.

Mutations in this gene cause a form of spinocerebellar ataxia, SCA5, that is characterized by neurodegeneration, progressive locomotor incoordination, dysarthria, and uncoordinated eye movements. Mutations in spectrins are a previously unknown cause of ataxia and neurodegenerative disease that affect membrane proteins involved in glutamate signaling. Spectrin-beta IIIs have been recognized as ataxia disease genes and their mutations cause spinocerebellar ataxia type 5 (SCA5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-25371
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-30941
Species: Hu, Rt
Applications: IHC, WB
NBP2-56984
Species: Hu
Applications: ICC/IF
NBP2-48740
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-90063
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP3-25535
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92476
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32535
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
NB100-1869
Species: Hu, Mu, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP3-04588
Species: Hu, Mu, Rt
Applications: WB
H00003748-M01
Species: Hu, Mu, Rb
Applications: ELISA, ICC/IF, WB
NBP2-59319
Species: Hu, Rt
Applications: ICC/IF, IP, WB
NBP1-87086
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-14336
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-38195
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-48703PEP
Species: Hu
Applications: AC

Publications for Spectrin beta 3 Recombinant Protein Antigen (NBP2-48703PEP) (0)

There are no publications for Spectrin beta 3 Recombinant Protein Antigen (NBP2-48703PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Spectrin beta 3 Recombinant Protein Antigen (NBP2-48703PEP) (0)

There are no reviews for Spectrin beta 3 Recombinant Protein Antigen (NBP2-48703PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Spectrin beta 3 Recombinant Protein Antigen (NBP2-48703PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Spectrin beta 3 Products

Research Areas for Spectrin beta 3 Recombinant Protein Antigen (NBP2-48703PEP)

Find related products by research area.

Blogs on Spectrin beta 3

There are no specific blogs for Spectrin beta 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Spectrin beta 3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SPTBN2