SPDEF Antibody (4A5)

Images

 
Western Blot: SPDEF Antibody (4A5) [H00025803-M01] - Analysis of SPDEF expression in transfected 293T cell line by SPDEF monoclonal antibody (M01), clone 4A5.Lane 1: SPDEF transfected lysate(37.518 KDa).Lane 2: ...read more
Sandwich ELISA: SPDEF Antibody (4A5) [H00025803-M01] - Detection limit for recombinant GST tagged SPDEF is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SPDEF Antibody (4A5) Summary

Immunogen
SPDEF (NP_036523, 92 a.a. ~ 200 a.a) partial recombinant protein with GST tag. QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKD IETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAF QELAGKELCAMSEEQFRQRSPLGGD
Specificity
SPDEF - SAM pointed domain containing ets transcription factor
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SPDEF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPDEF Antibody (4A5)

  • bA375E1.3
  • PDEFRP11-375E1__A.3
  • Prostate epithelium-specific Ets transcription factor
  • Prostate-derived Ets factor
  • Prostate-specific Ets
  • PSE
  • SAM pointed domain containing ets transcription factor
  • SAM pointed domain-containing Ets transcription factor

Background

SPDEF, also known as PDEF is an ETS transcription factor expressed in the prostate epithelial cells. It is thought to act as an androgen-independent transactivator of the prostate-specific antigen (PSA) promoter and also as a transcriptional activator for the SERPINB5 promoter. It is highly expressed in prostate carcinoma cells and is thought to be involved in the regulation of the prostate gland and/or prostate cancer development. It is also expressed in epithelial breast carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-87962
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-58560
Species: Hu
Applications: ICC/IF
NBP1-87780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP2-57713
Species: Hu
Applications: WB, ICC/IF
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF

Publications for SPDEF Antibody (H00025803-M01) (0)

There are no publications for SPDEF Antibody (H00025803-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPDEF Antibody (H00025803-M01) (0)

There are no reviews for SPDEF Antibody (H00025803-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPDEF Antibody (H00025803-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPDEF Products

Bioinformatics Tool for SPDEF Antibody (H00025803-M01)

Discover related pathways, diseases and genes to SPDEF Antibody (H00025803-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPDEF Antibody (H00025803-M01)

Discover more about diseases related to SPDEF Antibody (H00025803-M01).
 

Pathways for SPDEF Antibody (H00025803-M01)

View related products by pathway.

PTMs for SPDEF Antibody (H00025803-M01)

Learn more about PTMs related to SPDEF Antibody (H00025803-M01).

Blogs on SPDEF

There are no specific blogs for SPDEF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPDEF Antibody (4A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol SPDEF
Entrez
OMIM
Uniprot