SPATA32 Antibody

Images

 
Immunohistochemistry-Paraffin: C17orf46 Antibody [NBP1-93913] - Staining of human testis shows strong cytoplasmic positivity in spermatozoa.
Immunohistochemistry-Paraffin: C17orf46 Antibody [NBP1-93913] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPATA32 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVHSNMGLPTPQTFRPWSLNSNCRSFTEENHVSACHHSISAQTSKHLFWANKLIQASEHSLQRAINMQLNNGSAGQPIRSPL
Specificity
Specificity of human C17orf46 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPATA32
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPATA32 Recombinant Protein Antigen (NBP1-93913PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPATA32 Antibody

  • AEP2
  • C17orf46
  • chromosome 17 open reading frame 46
  • FLJ25414
  • hypothetical protein LOC124783
  • spermatogenesis associated 32
  • TEX34
  • VAD1.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, Gp, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, KD, KO
NBP2-38252
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
AF2199
Species: Hu
Applications: WB, IP
NBP1-97491
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Gp, Ha, Pm, Rb, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
NBP2-45731
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-33427
Species: Hu
Applications: WB, ICC/IF, ChIP
NBP1-93913
Species: Hu
Applications: IHC, IHC-P

Publications for SPATA32 Antibody (NBP1-93913) (0)

There are no publications for SPATA32 Antibody (NBP1-93913).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPATA32 Antibody (NBP1-93913) (0)

There are no reviews for SPATA32 Antibody (NBP1-93913). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPATA32 Antibody (NBP1-93913) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SPATA32 Products

Bioinformatics Tool for SPATA32 Antibody (NBP1-93913)

Discover related pathways, diseases and genes to SPATA32 Antibody (NBP1-93913). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPATA32

There are no specific blogs for SPATA32, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPATA32 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPATA32