SPATA19 Antibody

Images

 
Immunohistochemistry-Paraffin: SPATA19 Antibody [NBP2-31979] - Staining of human testis shows strong cytoplasmic positivity in spermatids.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPATA19 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KHHLSKSDLLANQSQEVLEERTRIQFIRWSHTRIFQVPSEMTEDIMRDRIEQVRRSISRLTDVSAQDFSMRPSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPATA19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Western Blot reactivity reported in (PMID: 26265198).
Control Peptide
SPATA19 Protein (NBP2-31979PEP)
Publications
Read Publication using
NBP2-31979 in the following applications:

Reactivity Notes

Mouse reactivity reported in (PMID: 26265198).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPATA19 Antibody

  • cancer/testis antigen 132
  • CT132
  • FLJ25851
  • SPAS1
  • spergen 1
  • spergen1
  • spergen-1
  • spermatogenesis associated 19
  • spermatogenesis-associated protein 19, mitochondrial
  • Spermatogenic cell-specific gene 1 protein
  • spermatogenic specific-gene1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5457
Species: Hu, Mu, Rt
Applications: WB
NB100-2216
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, PAGE
NBP1-90614
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004957-M01
Species: Hu, Ce
Applications: WB, ELISA, ICC/IF, IHC
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NBP1-77242
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-60018
Species: Hu
Applications: WB
NBP2-38050
Species: Hu
Applications: IHC, IHC-P
NBP1-84357
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF4036
Species: Hu
Applications: WB, Simple Western
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-84345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC

Publications for SPATA19 Antibody (NBP2-31979)(1)

Reviews for SPATA19 Antibody (NBP2-31979) (0)

There are no reviews for SPATA19 Antibody (NBP2-31979). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPATA19 Antibody (NBP2-31979) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPATA19 Products

Bioinformatics Tool for SPATA19 Antibody (NBP2-31979)

Discover related pathways, diseases and genes to SPATA19 Antibody (NBP2-31979). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPATA19 Antibody (NBP2-31979)

Discover more about diseases related to SPATA19 Antibody (NBP2-31979).
 

Pathways for SPATA19 Antibody (NBP2-31979)

View related products by pathway.

Blogs on SPATA19

There are no specific blogs for SPATA19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPATA19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPATA19
Uniprot