SPAG9 Antibody


Immunocytochemistry/ Immunofluorescence: SPAG9 Antibody [NBP2-56914] - Staining of human cell line RH-30 shows localization to cytosol & microtubule organizing center.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

SPAG9 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NLSGGKTRDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKVL
Specificity of human SPAG9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (91%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPAG9 Recombinant Protein Antigen (NBP2-56914PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for SPAG9 Antibody

  • Cancer/testis antigen 89
  • c-Jun NH2-terminal kinase-associated leucine zipper protein
  • C-Jun-amino-terminal kinase-interacting protein 4
  • CT89JIP4
  • FLJ14006
  • FLJ26141
  • FLJ34602
  • HLC4
  • HLC-6
  • HSS
  • Human lung cancer oncogene 6 protein
  • JNK interacting protein
  • JNK/SAPK-associated protein
  • JNK-associated leucine-zipper protein
  • JNK-interacting protein 4
  • KIAA0516JIP-4
  • lung cancer oncogene 4
  • MAPK8IP4
  • Max-binding protein
  • MGC117291
  • MGC14967
  • MGC74461
  • Mitogen-activated protein kinase 8-interacting protein 4
  • PIG6
  • proliferation-inducing gene 6
  • Proliferation-inducing protein 6
  • Protein highly expressed in testis
  • sperm associated antigen 9
  • Sperm surface protein
  • Sperm-associated antigen 9
  • Sperm-specific protein
  • Sunday driver 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for SPAG9 Antibody (NBP2-56914) (0)

There are no publications for SPAG9 Antibody (NBP2-56914).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPAG9 Antibody (NBP2-56914) (0)

There are no reviews for SPAG9 Antibody (NBP2-56914). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SPAG9 Antibody (NBP2-56914) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SPAG9 Products

Bioinformatics Tool for SPAG9 Antibody (NBP2-56914)

Discover related pathways, diseases and genes to SPAG9 Antibody (NBP2-56914). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPAG9 Antibody (NBP2-56914)

Discover more about diseases related to SPAG9 Antibody (NBP2-56914).

Pathways for SPAG9 Antibody (NBP2-56914)

View related products by pathway.

PTMs for SPAG9 Antibody (NBP2-56914)

Learn more about PTMs related to SPAG9 Antibody (NBP2-56914).

Research Areas for SPAG9 Antibody (NBP2-56914)

Find related products by research area.

Blogs on SPAG9

There are no specific blogs for SPAG9, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SPAG9 Antibody and receive a gift card or discount.


Gene Symbol SPAG9