SP140 Antibody

Images

 
Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-81275] - Staining of human small intestine shows strong nuclear positivity in lymphoid cells.
Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-81275] - Staining of human lymph node shows strong nuclear positivity in lymphoid cells.
Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-81275] - Staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-81275] - Staining of human placenta shows strong nuclear positivity in lymphoid cells.
Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-81275] - Staining in human lymph node and pancreas tissues. Corresponding SP140 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SP140 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQNVCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEMDDIAVPQEALSSSPRCEPGFSSESCEQLALPKAGGGDAEDAPSLLPGGGVSCKLAIQIDEGESEEMPKLLP
Specificity
Specificity of human SP140 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SP140
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SP140 Protein (NBP1-81275PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SP140 Antibody

  • Lymphoid-restricted homolog of Sp100
  • lymphoid-specific SP100 homolog
  • LYSP100
  • LYSP100-A
  • LYSP100-B
  • MGC126440
  • Nuclear autoantigen Sp-140
  • nuclear body protein SP140
  • SP140 nuclear body protein
  • Speckled 140 kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86060
Species: Hu
Applications: WB, IHC, IHC-P, Micro
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
AF1141
Species: Mu
Applications: WB, IHC, IP
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP2-13809
Species: Hu
Applications: WB, IHC, IHC-P
AF4715
Species: Mu
Applications: WB
AF5525
Species: Hu
Applications: WB, IHC
AF755
Species: Mu
Applications: WB, Block
MAB1287
Species: Mu
Applications: WB
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
H00001820-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
H00005721-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-02984
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P, KO
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
NBP2-33434
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SP140 Antibody (NBP1-81275) (0)

There are no publications for SP140 Antibody (NBP1-81275).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP140 Antibody (NBP1-81275) (0)

There are no reviews for SP140 Antibody (NBP1-81275). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SP140 Antibody (NBP1-81275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SP140 Antibody (NBP1-81275)

Discover related pathways, diseases and genes to SP140 Antibody (NBP1-81275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP140 Antibody (NBP1-81275)

Discover more about diseases related to SP140 Antibody (NBP1-81275).
 

Pathways for SP140 Antibody (NBP1-81275)

View related products by pathway.

PTMs for SP140 Antibody (NBP1-81275)

Learn more about PTMs related to SP140 Antibody (NBP1-81275).

Blogs on SP140

There are no specific blogs for SP140, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SP140 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SP140