DRIL1 Antibody (1A11)

Images

 
Western Blot: DRIL1 Antibody (1A11) [H00001820-M01] - ARID3A monoclonal antibody (M01), clone 1A11 Analysis of ARID3A expression in K-562.
Immunocytochemistry/ Immunofluorescence: DRIL1 Antibody (1A11) [H00001820-M01] - Analysis of monoclonal antibody to ARID3A on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: DRIL1 Antibody (1A11) [H00001820-M01] - Analysis of monoclonal antibody to ARID3A on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.
Western Blot: DRIL1 Antibody (1A11) [H00001820-M01] - analysis of ARID3A expression in transfected 293T cell line by ARID3A monoclonal antibody (M01), clone 1A11. Lane 1: ARID3A transfected lysate (63 KDa). Lane 2: ...read more
Western Blot: DRIL1 Antibody (1A11) [H00001820-M01] - Analysis of ARID3A over-expressed 293 cell line, cotransfected with ARID3A Validated Chimera RNAi ( Cat # H00001820-R01V ) (Lane 2) or non-transfected control (Lane ...read more
ELISA: DRIL1 Antibody (1A11) [H00001820-M01] - Detection limit for recombinant GST tagged ARID3A is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, RNAi
Clone
1A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
     

Genetic Strategies

   

Order Details

DRIL1 Antibody (1A11) Summary

Immunogen
ARID3A (NP_005215 317 a.a. - 416 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS
Specificity
ARID3A - AT rich interactive domain 3A (BRIGHT- like)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARID3A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
Application Notes
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA.
Publications
Read Publication using H00001820-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DRIL1 Antibody (1A11)

  • ARID domain-containing 3A
  • ARID domain-containing protein 3A
  • AT rich interactive domain 3A (BRIGHT- like) protein
  • AT rich interactive domain 3A (BRIGHT- like)
  • AT rich interactive domain 3A (BRIGHT-like)
  • AT-rich interactive domain-containing protein 3A
  • B-cell regulator of IgH transcription
  • BRIGHT
  • dead ringer-like 1
  • Dead ringer-like protein 1
  • DRIL1dead ringer-like 1 (Drosophila)
  • DRIL3
  • DRX
  • E2F-binding protein 1
  • E2FBP1

Background

This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33596
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut
NBP1-90010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
AF4715
Species: Mu
Applications: WB
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56467
Species: Hu, Ca, Pm
Applications: WB
AF6897
Species: Hu, Mu
Applications: WB, IHC

Publications for DRIL1 Antibody (H00001820-M01)(1)

Reviews for DRIL1 Antibody (H00001820-M01) (0)

There are no reviews for DRIL1 Antibody (H00001820-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DRIL1 Antibody (H00001820-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DRIL1 Products

Bioinformatics Tool for DRIL1 Antibody (H00001820-M01)

Discover related pathways, diseases and genes to DRIL1 Antibody (H00001820-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DRIL1 Antibody (H00001820-M01)

Discover more about diseases related to DRIL1 Antibody (H00001820-M01).
 

Pathways for DRIL1 Antibody (H00001820-M01)

View related products by pathway.

PTMs for DRIL1 Antibody (H00001820-M01)

Learn more about PTMs related to DRIL1 Antibody (H00001820-M01).

Blogs on DRIL1

There are no specific blogs for DRIL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DRIL1 Antibody (1A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol ARID3A
Entrez
OMIM
Uniprot