| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SOX9. Source: E. coli Amino Acid Sequence: SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | SOX9 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52943. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW | 31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for SOX9 Recombinant Protein Antigen (NBP2-52943PEP)Find related products by research area.
|
|
Role of GFAP in astrocytes: Lessons from induced pluripotent stem cells in Alexander disease patients By Michalina Hanzel, PhDAlexander disease is a progressive and fatal neurological disease with phenotypes ranging from myelination abnormalities, gait ataxia and megalencephaly to predisposition to seizures. It is an ... Read full blog post. |
|
Deriving neural precursor cells from human induced pluripotent stem cells By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions... Read full blog post. |
|
The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura. It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol... Read full blog post. |
|
SOX9 - Be careful, I can reverse your gender! SOX9 is a member of the SOX family of HMG DNA-binding domain transcription factors. The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. cAMP and protein kinase A (PKA) st... Read full blog post. |
|
Using the Hif-1 Alpha Antibody in Prostate Cancer Research The Hypoxia-inducible Factor 1 (HIF1) protein is a heterodimeric transcription factor which plays an important role in mammalian oxygen homeostasis in conditions of hypoxia, or low oxygen concentration. HIF-1 alpha antibody reagents are widely used in... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SOX9 |