SOX9 Antibody

Images

 
Western Blot: SOX9 Antibody [H00006662-A01] - Analysis of SOX9 expression in Hela S3 NE (Cat # L013V3 ).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SOX9 Antibody Summary

Immunogen
SOX9 (NP_000337, 400 a.a. - 509 a.a.) partial recombinant protein with GST tag. EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
Marker
Sertoli Cell Marker
Specificity
SOX9 - SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SOX9
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SOX9 Antibody

  • campomelic dysplasia, autosomal sex-reversal
  • CMD 1
  • CMD1
  • CMPD1
  • SOX9
  • SRA1SRY (sex-determining region Y)-box 9 protein
  • SRY (sex determining region Y)-box 9
  • SRY-related HMG-box, gene 9
  • transcription factor SOX-9

Background

The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
355-BM/CF
Species: Hu, Mu, Rt
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-H7431-00
Species: Hu
Applications: WB
355-BM/CF
Species: Hu, Mu, Rt
AF5286
Species: Hu
Applications: WB
AF2864
Species: Hu
Applications: WB, ICC
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-59987
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SOX9 Antibody (H00006662-A01) (0)

There are no publications for SOX9 Antibody (H00006662-A01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX9 Antibody (H00006662-A01) (0)

There are no reviews for SOX9 Antibody (H00006662-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX9 Antibody (H00006662-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOX9 Products

Bioinformatics Tool for SOX9 Antibody (H00006662-A01)

Discover related pathways, diseases and genes to SOX9 Antibody (H00006662-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX9 Antibody (H00006662-A01)

Discover more about diseases related to SOX9 Antibody (H00006662-A01).
 

Pathways for SOX9 Antibody (H00006662-A01)

View related products by pathway.

PTMs for SOX9 Antibody (H00006662-A01)

Learn more about PTMs related to SOX9 Antibody (H00006662-A01).
 

Research Areas for SOX9 Antibody (H00006662-A01)

Find related products by research area.

Blogs on SOX9.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

SOX9 - Be careful, I can reverse your gender!
SOX9 is a member of the SOX family of HMG DNA-binding domain transcription factors. The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. cAMP and protein kinase A (PKA) st...  Read full blog post.

Using the Hif-1 Alpha Antibody in Prostate Cancer Research
The Hypoxia-inducible Factor 1 (HIF1) protein is a heterodimeric transcription factor which plays an important role in mammalian oxygen homeostasis in conditions of hypoxia, or low oxygen concentration. HIF-1 alpha antibody reagents are widely used in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX9
Entrez
OMIM
Uniprot