SOX9 Antibody (3C10) - Azide and BSA Free

Western Blot: SOX9 Antibody (3C10) [H00006662-M02] - SOX9 monoclonal antibody (M02), clone 3C10 Analysis of SOX9 expression in HepG2.

Immunocytochemistry/Immunofluorescence: SOX9 Antibody (3C10) [H00006662-M02] - Analysis of monoclonal antibody to SOX9 on HepG2 cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: SOX9 Antibody (3C10) [H00006662-M02] - Analysis of monoclonal antibody to SOX9 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 0.7 ug/ml.

Western Blot: SOX9 Antibody (3C10) [H00006662-M02] - Analysis of SOX9 expression in transfected 293T cell line by SOX9 monoclonal antibody (M02), clone 3C10.Lane 1: SOX9 transfected lysate(56.1 KDa).Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: SOX9 Antibody (3C10) [H00006662-M02] - analysis of SOX9 in formalin-fixed, paraffin-embedded human fetal developing pancreas tissue using anti-SOX9 antibody. Image from verified customer review.

Immunoprecipitation: SOX9 Antibody (3C10) [H00006662-M02] - Analysis of SOX9 transfected lysate using anti-SOX9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SOX9 MaxPab rabbit polyclonal antibody.

ELISA: SOX9 Antibody (3C10) [H00006662-M02] - Detection limit for recombinant GST tagged SOX9 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, Func, ICC/IF, IHC, IP
• Clone: 3C10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SOX9 Antibody (3C10) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
• Marker: Sertoli Cell Marker
• Specificity: SOX9 (3C10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SOX9
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • In-situ Hybridization
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. Use in Immunohistochemistry reported in scientific literature (PMID: 26030748). Use in In-situ Hybridization reported in scientific literature (PMID: 26546129).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SOX9 Antibody (3C10) - Azide and BSA Free

• campomelic dysplasia, autosomal sex-reversal
• CMD 1
• CMD1
• CMPD1
• SOX9
• SRA1SRY (sex-determining region Y)-box 9 protein
• SRY (sex determining region Y)-box 9
• SRY-related HMG-box, gene 9
• transcription factor SOX-9

Background

The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SOX9 Antibody (H00006662-M02)(12)

Publications using H00006662-M02

• Kim YI, Tseng YC, Ayaz G et al. SOX9 is a key component of RUNX2-regulated transcriptional circuitry in osteosarcoma Cell & Bioscience 2023-07-25 [PMID: 37491298]
• Eshini P, Joana M, Tingjian W et al. BAF complex maintains glioma stem cells in pediatric H3K27M-glioma. Cancer Discov. 2022-10-28 [PMID: 36305736]
• Wang Z, Sun D, Chen Yj Et Al. Cell Lineage-Based Stratification for Glioblastoma Cancer Cell 2020-06-23 [PMID: 32649888] (Human)
• Janssen JN, Batschkus S, Schimmel S et al. The Influence of TGF-beta 3, EGF, and BGN on SOX9 and RUNX2 Expression in Human Chondrogenic Progenitor Cells. J Histochem Cytochem. 2018-11-15 [PMID: 30431382]
• Yang Z, Zhang C, Qi W et al. GLI1 promotes cancer stemness through intracellular signaling pathway PI3K/Akt/NF?B in colorectal adenocarcinoma. Exp Cell Res 2018-10-12 [PMID: 30321514]
• Wollenberg AL, O'Shea TM, Kim JH et al. Injectable polypeptide hydrogels via methionine modification for neural stem cell delivery Biomaterials 2018-09-01 [PMID: 29657091]
• Jurczyk A, Nowosielska A, Przewozniak N et al. Beyond the brain: disrupted in schizophrenia 1 regulates pancreatic B-cell function via glycogen synthase kinase-3B. FASEB J. 2015-11-06 [PMID: 26546129] (ISH, Human)
• Burdelski C, Bujupi E, Tsourlakis MC et al. Loss of SOX9 Expression Is Associated with PSA Recurrence in ERG-Positive and PTEN Deleted Prostate Cancers. PLoS One 2015-01-01 [PMID: 26030748] (IF/IHC)
• Loebel C, Czekanska E, Bruderer M et al. In vitro osteogenic potential of human bone marrow derived MSCs is predicted by Runx2/Sox9 Ratio. Tissue Eng Part A. 2014-06-18 [PMID: 24980654]
• Yun JY, Kim YA, Choe JY et al. Expression of cancer stem cell markers is more frequent in anaplastic thyroid carcinoma compared to papillary thyroid carcinoma and is related to adverse clinical outcome. J Clin Pathol. 2013-08-28 [PMID: 23986551]
• Hagel C, Treszl A, Fehlert J et al. Supra- and infratentorial pediatric ependymomas differ significantly in NeuN, p75 and GFAP expression. J Neurooncol. 2013-01-31 [PMID: 23371454]
• Hodgin JB, Borczuk AC, Nasr SH et al. A molecular profile of focal segmental glomerulosclerosis from formalin-fixed, paraffin-embedded tissue. Am J Pathol;177(4):1674-86. 2010-10-01 [PMID: 20847290]

Review for SOX9 Antibody (H00006662-M02) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Valentina Villani IHC-P Human 03/24/2015

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Human fetal pancreas
• Species: Human

Bioinformatics

• Gene Symbol: SOX9
• Entrez:
  • 6662(Human)
• OMIM:
  • 114290(Human)
• Uniprot:
  • NP_000337(Human)