SOX9 Antibody (3C10)

Images

 
Western Blot: SOX9 Antibody (3C10) [H00006662-M02] - SOX9 monoclonal antibody (M02), clone 3C10 Analysis of SOX9 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: SOX9 Antibody (3C10) [H00006662-M02] - Analysis of monoclonal antibody to SOX9 on HepG2 cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: SOX9 Antibody (3C10) [H00006662-M02] - Analysis of monoclonal antibody to SOX9 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 0.7 ug/ml.
Western Blot: SOX9 Antibody (3C10) [H00006662-M02] - Analysis of SOX9 expression in transfected 293T cell line by SOX9 monoclonal antibody (M02), clone 3C10.Lane 1: SOX9 transfected lysate(56.1 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: SOX9 Antibody (3C10) [H00006662-M02] - analysis of SOX9 in formalin-fixed, paraffin-embedded human fetal developing pancreas tissue using anti-SOX9 antibody. Image from verified customer ...read more
Immunoprecipitation: SOX9 Antibody (3C10) [H00006662-M02] - Analysis of SOX9 transfected lysate using anti-SOX9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SOX9 MaxPab rabbit polyclonal ...read more
ELISA: SOX9 Antibody (3C10) [H00006662-M02] - Detection limit for recombinant GST tagged SOX9 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, IP
Clone
3C10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SOX9 Antibody (3C10) Summary

Immunogen
SOX9 (NP_000337, 400 a.a. - 509 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
Marker
Sertoli Cell Marker
Specificity
SOX9 (3C10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SOX9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Reviewed Applications
Read 1 Review rated 5
using
H00006662-M02 in the following applications:

Publications
Read Publications using
H00006662-M02 in the following applications:

  • IHC
    1 publication
  • ISH
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SOX9 Antibody (3C10)

  • campomelic dysplasia, autosomal sex-reversal
  • CMD 1
  • CMD1
  • CMPD1
  • SOX9
  • SRA1SRY (sex-determining region Y)-box 9 protein
  • SRY (sex determining region Y)-box 9
  • SRY-related HMG-box, gene 9
  • transcription factor SOX-9

Background

The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
355-BM/CF
Species: Hu, Mu, Rt
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-H7431-00
Species: Hu
Applications: WB
355-BM/CF
Species: Hu, Mu, Rt
AF5286
Species: Hu
Applications: WB
AF2864
Species: Hu
Applications: WB, ICC
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-59987
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SOX9 Antibody (H00006662-M02)(6)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, ISH.


Filter By Application
IHC
(1)
ISH
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for SOX9 Antibody (H00006662-M02) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: IHC-P.

Reviews using H00006662-M02:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin SOX9 H00006662-M02
Enlarge
reviewed by:
Valentina Villani
IHC-P Human 03/24/2015
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedHuman fetal pancreas
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SOX9 Antibody (H00006662-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOX9 Products

Bioinformatics Tool for SOX9 Antibody (H00006662-M02)

Discover related pathways, diseases and genes to SOX9 Antibody (H00006662-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX9 Antibody (H00006662-M02)

Discover more about diseases related to SOX9 Antibody (H00006662-M02).
 

Pathways for SOX9 Antibody (H00006662-M02)

View related products by pathway.

PTMs for SOX9 Antibody (H00006662-M02)

Learn more about PTMs related to SOX9 Antibody (H00006662-M02).
 

Research Areas for SOX9 Antibody (H00006662-M02)

Find related products by research area.

Blogs on SOX9.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

SOX9 - Be careful, I can reverse your gender!
SOX9 is a member of the SOX family of HMG DNA-binding domain transcription factors. The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. cAMP and protein kinase A (PKA) st...  Read full blog post.

Using the Hif-1 Alpha Antibody in Prostate Cancer Research
The Hypoxia-inducible Factor 1 (HIF1) protein is a heterodimeric transcription factor which plays an important role in mammalian oxygen homeostasis in conditions of hypoxia, or low oxygen concentration. HIF-1 alpha antibody reagents are widely used in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Valentina Villani
03/24/2015
Application: IHC-P
Species: Human

Bioinformatics

Gene Symbol SOX9
Entrez
OMIM
Uniprot