SOX9 Antibody (2A2)

Images

 
Western Blot: SOX9 Antibody (2A2) [H00006662-M01] - Analysis of SOX9 expression in transfected 293T cell line by SOX9 monoclonal antibody (M01), clone 2A2.Lane 1: SOX9 transfected lysate(63.639 KDa).Lane 2: ...read more
ELISA: SOX9 Antibody (2A2) [H00006662-M01] - Detection limit for recombinant GST tagged SOX9 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
2A2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SOX9 Antibody (2A2) Summary

Immunogen
SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
Marker
Sertoli Cell Marker
Specificity
SOX9 - SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SOX9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.
Publications
Read Publications using H00006662-M01.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25224227). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SOX9 Antibody (2A2)

  • campomelic dysplasia, autosomal sex-reversal
  • CMD 1
  • CMD1
  • CMPD1
  • SOX9
  • SRA1SRY (sex-determining region Y)-box 9 protein
  • SRY (sex determining region Y)-box 9
  • SRY-related HMG-box, gene 9
  • transcription factor SOX-9

Background

The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52823
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-H7431-00
Species: Hu
Applications: WB
AF5286
Species: Hu
Applications: WB
AF2864
Species: Hu
Applications: WB, ICC
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-86149
Species: Hu
Applications: WB, IHC, IHC-P
H00006662-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for SOX9 Antibody (H00006662-M01)(4)

Reviews for SOX9 Antibody (H00006662-M01) (0)

There are no reviews for SOX9 Antibody (H00006662-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SOX9 Antibody (H00006662-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SOX9 Products

Bioinformatics Tool for SOX9 Antibody (H00006662-M01)

Discover related pathways, diseases and genes to SOX9 Antibody (H00006662-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX9 Antibody (H00006662-M01)

Discover more about diseases related to SOX9 Antibody (H00006662-M01).
 

Pathways for SOX9 Antibody (H00006662-M01)

View related products by pathway.

PTMs for SOX9 Antibody (H00006662-M01)

Learn more about PTMs related to SOX9 Antibody (H00006662-M01).
 

Research Areas for SOX9 Antibody (H00006662-M01)

Find related products by research area.

Blogs on SOX9.

Role of GFAP in astrocytes: Lessons from induced pluripotent stem cells in Alexander disease patients
By Michalina Hanzel, PhDAlexander disease is a progressive and fatal neurological disease with phenotypes ranging from myelination abnormalities, gait ataxia and megalencephaly to predisposition to seizures. It is an...  Read full blog post.

Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions...  Read full blog post.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

SOX9 - Be careful, I can reverse your gender!
SOX9 is a member of the SOX family of HMG DNA-binding domain transcription factors. The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. cAMP and protein kinase A (PKA) st...  Read full blog post.

Using the Hif-1 Alpha Antibody in Prostate Cancer Research
The Hypoxia-inducible Factor 1 (HIF1) protein is a heterodimeric transcription factor which plays an important role in mammalian oxygen homeostasis in conditions of hypoxia, or low oxygen concentration. HIF-1 alpha antibody reagents are widely used in...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX9 Antibody (2A2) and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX9
Entrez
OMIM
Uniprot