SOX7 Antibody

Western Blot: SOX7 Antibody [NBP1-80373] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry-Paraffin: SOX7 Antibody [NBP1-80373] - Human Heart Tissue, antibody concentration 5.0ug/ml.

Product Discontinued

SOX7 Antibody Summary

• Immunogen: Synthetic peptide directed towards the N terminal of human SOX7. Peptide sequence DKGSESRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SOX7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against SOX7 and was validated on Western blot.
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SOX7 Antibody

• MGC10895
• SOX7 transcription factor
• SOX7
• SRY (sex determining region Y)-box 7
• transcription factor SOX-7

Background

SOX7 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may play a role in tumorigenesis. A similar protein in mice is involved in the regulation of the wingless-type MMTV integration site family (Wnt) pathway. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SOX7
• Uniprot:
  • NP_113627(Human)