SOX21 Antibody (2G10) - Azide and BSA Free Summary
| Immunogen |
SOX21 (NP_009015, 224 a.a. ~ 265 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQL |
| Specificity |
SOX21 - SRY (sex determining region Y)-box 21 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
SOX21 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA 1:100-1:2000
- Immunocytochemistry/ Immunofluorescence 1:10-1:500
- Sandwich ELISA 1:100-1:2000
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Reactivity Notes
Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SOX21 Antibody (2G10) - Azide and BSA Free
Background
SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ChIP, ICC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Publications for SOX21 Antibody (H00011166-M01) (0)
There are no publications for SOX21 Antibody (H00011166-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SOX21 Antibody (H00011166-M01) (0)
There are no reviews for SOX21 Antibody (H00011166-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SOX21 Antibody (H00011166-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SOX21 Products
Blogs on SOX21