SOX21 Antibody (2G10) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: SOX21 Antibody (2G10) [H00011166-M01] - Analysis of monoclonal antibody to SOX21 on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: SOX21 Antibody (2G10) [H00011166-M01] - Detection limit for recombinant GST tagged SOX21 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 2G10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SOX21 Antibody (2G10) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SOX21 Antibody (2G10) - Azide and BSA Free (H00011166-M01) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SOX21 (NP_009015, 224 a.a. ~ 265 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQL
• Specificity: SOX21 - SRY (sex determining region Y)-box 21
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SOX21
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SOX21 Antibody (2G10) - Azide and BSA Free

• SOX21
• SOX25
• SOX25SOX-A
• SOXA
• SRY (sex determining region Y)-box 21
• SRY-box 21
• transcription factor SOX-21

Background

SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SOX21
• Entrez:
  • 11166(Human)
• OMIM:
  • 604974(Human)
• Uniprot:
  • NP_009015(Human)