SOX18 Antibody (1C4) - Azide and BSA Free

Western Blot: SOX18 Antibody (1C4) [H00054345-M05] - Analysis of SOX18 expression in human kidney.

Immunocytochemistry/Immunofluorescence: SOX18 Antibody (1C4) [H00054345-M05] - Analysis of monoclonal antibody to SOX18 on HeLa cell. Antibody concentration 10 ug/ml

ELISA: SOX18 Antibody (1C4) [H00054345-M05] - Detection limit for recombinant GST tagged SOX18 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1C4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SOX18 Antibody (1C4) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SOX18 Antibody (1C4) - Azide and BSA Free (H00054345-M05) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SOX18 (NP_060889, 63 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EPGRYGLSPAGRGERQAADESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAERLRVQHLRDHP
• Specificity: SOX18 (1C4)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SOX18
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: This antibody is useful for ELISA and Western Blot.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SOX18 Antibody (1C4) - Azide and BSA Free

• HLTS
• SOX18
• SRY (sex determining region Y)-box 18
• SRY-box 18
• transcription factor SOX-18

Background

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This protein plays a role in hair, blood vessel, and lymphatic vessel development. Mutations in this gene have been associated with recessive and dominant forms of hypotrichosis-lymphedema-telangiectasia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SOX18
• Entrez:
  • 54345(Human)
• Uniprot:
  • NP_060889(Human)