SOX13 Antibody


Immunocytochemistry/ Immunofluorescence: SOX13 Antibody [NBP2-54996] - Staining of human cell line A-431 shows localization to nucleoplasm.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

SOX13 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DVLYPRAAGMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLT
Specificity of human SOX13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 87%, Rat 87%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for SOX13 Antibody

  • Islet cell antigen 12
  • MGC117216
  • Sox-13
  • SRY (sex determining region Y)-box 13ICA12islet cell 12
  • SRY-box 13
  • SRY-related HMG-box gene 13
  • transcription factor SOX-13
  • Type 1 diabetes autoantigen ICA12


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
Species: Hu
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: ICC/IF

Publications for SOX13 Antibody (NBP2-54996) (0)

There are no publications for SOX13 Antibody (NBP2-54996).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX13 Antibody (NBP2-54996) (0)

There are no reviews for SOX13 Antibody (NBP2-54996). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SOX13 Antibody (NBP2-54996) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SOX13 Products

Bioinformatics Tool for SOX13 Antibody (NBP2-54996)

Discover related pathways, diseases and genes to SOX13 Antibody (NBP2-54996). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX13 Antibody (NBP2-54996)

Discover more about diseases related to SOX13 Antibody (NBP2-54996).

Pathways for SOX13 Antibody (NBP2-54996)

View related products by pathway.

PTMs for SOX13 Antibody (NBP2-54996)

Learn more about PTMs related to SOX13 Antibody (NBP2-54996).

Research Areas for SOX13 Antibody (NBP2-54996)

Find related products by research area.

Blogs on SOX13

There are no specific blogs for SOX13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SOX13 Antibody and receive a gift card or discount.


Gene Symbol SOX13