Recombinant Human SorLA GST (N-Term) Protein

SDS-Page: Recombinant Human SorLA Protein [H00006653-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human SorLA GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 82-181 of Human SorLA
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: SORL1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 36.74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SorLA GST (N-Term) Protein

• C11orf32
• chromosome 11 open reading frame 32
• FLJ21930
• FLJ39258
• gp250
• Low-density lipoprotein receptor relative with 11 ligand-binding repeats
• LR11
• LR11LDLR relative with 11 ligand-binding repeats
• LRP9
• mosaic protein LR11
• SORL1
• SorLA
• SorLA-1SORLA
• sortilin-related receptor
• sortilin-related receptor, L(DLR class) A repeats containing
• sortilin-related receptor, L(DLR class) A repeats-containing
• Sorting protein-related receptor containing LDLR class A repeats

Background

SORL1 is likely to be a multifunctional endocytic receptor, that may be implicated in the uptake of lipoproteins and of proteases. It binds LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. SORL1 binds the receptor-associated protein (RAP). It could play a role in cell-cell interaction. SORL1 is expressed mainly in brain, where it is most abundant in the cerebellum, cerebral cortex and the occipital pole; low expression in the putamen and the thalamus. It is also found in spinal cord, testis, liver, kidney and pancreas with detectable levels in placenta, lung and heart. Moreover, it is expressed in the prostate, ovary, thyroid and spleen, but not found in kidney, liver, lung, skeletal muscle, bone marrow and adrenals.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: SORL1