We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human SorLA GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human SorLA Protein [H00006653-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related SorLA Peptides and Proteins

Order Details


    • Catalog Number
      H00006653-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human SorLA GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 82-181 of Human SorLA

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SORL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SorLA GST (N-Term) Protein

  • C11orf32
  • chromosome 11 open reading frame 32
  • FLJ21930
  • FLJ39258
  • gp250
  • Low-density lipoprotein receptor relative with 11 ligand-binding repeats
  • LR11
  • LR11LDLR relative with 11 ligand-binding repeats
  • LRP9
  • mosaic protein LR11
  • SORL1
  • SorLA
  • SorLA-1SORLA
  • sortilin-related receptor
  • sortilin-related receptor, L(DLR class) A repeats containing
  • sortilin-related receptor, L(DLR class) A repeats-containing
  • Sorting protein-related receptor containing LDLR class A repeats

Background

SORL1 is likely to be a multifunctional endocytic receptor, that may be implicated in the uptake of lipoproteins and of proteases. It binds LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. SORL1 binds the receptor-associated protein (RAP). It could play a role in cell-cell interaction. SORL1 is expressed mainly in brain, where it is most abundant in the cerebellum, cerebral cortex and the occipital pole; low expression in the putamen and the thalamus. It is also found in spinal cord, testis, liver, kidney and pancreas with detectable levels in placenta, lung and heart. Moreover, it is expressed in the prostate, ovary, thyroid and spleen, but not found in kidney, liver, lung, skeletal muscle, bone marrow and adrenals.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
AF2934
Species: Mu
Applications: Block, IHC, Simple Western, WB
NB100-64808
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB931
Species: Hu, Mu
Applications: CyTOF-ready, IHC, ICFlow, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
DUP00
Species: Hu
Applications: ELISA
NBP1-86096
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD
H00009961-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP3-14454
Species: Hu
Applications: IHC,  IHC-P
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NB100-74513
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
AF2258
Species: Mu
Applications: IHC, WB
NB100-1397
Species: Ca, Ch, ChHa, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
MAB3067
Species: Hu, Mu
Applications: WB

Publications for SorLA Partial Recombinant Protein (H00006653-Q01) (0)

There are no publications for SorLA Partial Recombinant Protein (H00006653-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SorLA Partial Recombinant Protein (H00006653-Q01) (0)

There are no reviews for SorLA Partial Recombinant Protein (H00006653-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SorLA Partial Recombinant Protein (H00006653-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SorLA Products

Blogs on SorLA

There are no specific blogs for SorLA, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SorLA GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SORL1