We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SORBS2 Recombinant Protein Antigen

Images

 
There are currently no images for SORBS2 Protein (NBP2-32672PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SORBS2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SORBS2.

Source: E. coli

Amino Acid Sequence: PERNSSLRALRRSPLHQPLHPLPPDGAIHCPPYQNDCGRMPRSASFQDVDTANSSCHHQDRGGALQDRESPRSYSSTLTDMGRSAPRER

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SORBS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32672.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SORBS2 Recombinant Protein Antigen

  • Arg/Abl interacting protein
  • Arg/Abl-interacting protein 2
  • ArgBP2
  • ARGBP2PRO0618
  • FLJ93447
  • KIAA0777Arg binding protein 2
  • sorbin and SH3 domain containing 2
  • sorbin and SH3 domain-containing protein 2
  • Sorbin

Background

Arg and c-Abl represent the mammalian members of the Abelson family of non-receptor protein-tyrosine kinases. They interact with the Arg/Abl binding proteins via the SH3 domains present in the carboxy end of the latter group of proteins. This gene encodes the sorbin and SH3 domain containing 2 protein. It has three C-terminal SH3 domains and an N-terminal sorbin homology (SoHo) domain that interacts with lipid raft proteins. The subcellular localization of this protein in epithelial and cardiac muscle cells suggests that it functions as an adapter protein to assemble signaling complexes in stress fibers, and that it is a potential link between Abl family kinases and the actin cytoskeleton. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86641
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-49695
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-20861
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86644
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF6386
Species: Hu
Applications: IP, WB
AF5514
Species: Hu, Mu
Applications: WB
NBP3-52290
Species: Hu
Applications:  IHC-P, WB
NBP2-76393
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-01650
Species: Hu, Pm, Mu
Applications: Flow, IHC,  IHC-P, WB
NBP2-37574
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-62489
Species: Dr, Hu, Mu
Applications: WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-60666
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB600-1293
Species: Am, Bv, Ca, Ch, Hu, Mu, Rt, Tr
Applications: ICC/IF, IHC, IHC-Fr, Simple Western, Single-Cell Western, WB
NBP3-38370
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-32672PEP
Species: Hu
Applications: AC

Publications for SORBS2 Protein (NBP2-32672PEP) (0)

There are no publications for SORBS2 Protein (NBP2-32672PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SORBS2 Protein (NBP2-32672PEP) (0)

There are no reviews for SORBS2 Protein (NBP2-32672PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SORBS2 Protein (NBP2-32672PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SORBS2 Products

Research Areas for SORBS2 Protein (NBP2-32672PEP)

Find related products by research area.

Blogs on SORBS2

There are no specific blogs for SORBS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SORBS2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SORBS2