Somatostatin R5/SSTR5 Antibody (4O6N5) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Somatostatin R5/SSTR5 (P35346). MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQN |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
SSTR5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
39 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Somatostatin R5/SSTR5 Antibody (4O6N5)
Background
Official Gene Symbol: SSTR5 Gen Bank Accession Number: NP_001044 Gene ID: 6755 (human) Gene Map Locus: 16p13.3 (human) Somatostatin is a multifunctional protein affecting exocrine and endocrine protein secretion, neurotransmission, and neuronal modulation and regulating cell proliferation. All these functions of Somatostatin are executed through a class of GPCR protein family members called somatostatin receptor. Till date, 6 classes of somatostatin receptors have been discovered out of which SSTR5, 364A.A protein, is a receptor subtype expressed predominantly in the pituitary and hypothalamus region of brain. Studies revealed that SSTR5 contains seven transmembrane regions and undergoes homodimerization and also heterodimerizes with SSTR1. Although the specific functions of SSTR5 are still elusive, the studies indicate that it complements SSTR2 regulation of ACTH secretion. Polymorphisms in SSTR5 gene have been observed in patients with acromegaly.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Po, Rt
Applications: EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Mu
Applications: ICC, IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA
Publications for Somatostatin R5/SSTR5 Antibody (NBP3-16682) (0)
There are no publications for Somatostatin R5/SSTR5 Antibody (NBP3-16682).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Somatostatin R5/SSTR5 Antibody (NBP3-16682) (0)
There are no reviews for Somatostatin R5/SSTR5 Antibody (NBP3-16682).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Somatostatin R5/SSTR5 Antibody (NBP3-16682) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Somatostatin R5/SSTR5 Products
Research Areas for Somatostatin R5/SSTR5 Antibody (NBP3-16682)
Find related products by research area.
|
Blogs on Somatostatin R5/SSTR5