Somatostatin R4/SSTR4 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human Somatostatin R4/SSTR4. Peptide sequence: AKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFV The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SSTR4 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
1 mg/ml |
| Purity |
Protein A purified |
Alternate Names for Somatostatin R4/SSTR4 Antibody - BSA Free
Background
SSTR4 has been reported to be expressed in brain, gastrointestinal tract, pancreas, and prostate tissues. No ESTs have been identified. G-protein Coupled Receptors (GPCRs) comprise one of the largest families of signaling molecules with more than a thousand members currently predicted to exist. All GPCRs share a structural motif consisting of seven membrane-spanning helices, and exist in both active and inactive forms. An array of activating ligands participate in the conformation of GPCRs which leads to signaling via G-proteins and downstream effectors. Ongoing studies have also shown the vast series of reactions which participate in the negative regulation of GPCRs. This "turn-off" activity has tremendous implications for the physiological action of the cell, and continues to drive pharmacological research for new drug candidates. Two blockbuster drugs which have been developed as GPCR-targeted pharmaceuticals are Zyprexa (Eli Lilly) and Claritin (Schering-Plough) which have multi-billion dollar shares of the mental health and allergy markets, respectively.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Po, Rt
Applications: EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Po
Applications: Flow, ICC, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA
Publications for Somatostatin R4/SSTR4 Antibody (NBP2-88334) (0)
There are no publications for Somatostatin R4/SSTR4 Antibody (NBP2-88334).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Somatostatin R4/SSTR4 Antibody (NBP2-88334) (0)
There are no reviews for Somatostatin R4/SSTR4 Antibody (NBP2-88334).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Somatostatin R4/SSTR4 Antibody (NBP2-88334) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Somatostatin R4/SSTR4 Products
Research Areas for Somatostatin R4/SSTR4 Antibody (NBP2-88334)
Find related products by research area.
|
Blogs on Somatostatin R4/SSTR4