Somatostatin R4/SSTR4 Antibody - BSA Free

Immunohistochemistry-Paraffin: Somatostatin R4/SSTR4 Antibody [NBP2-39022] - Staining of human stomach shows moderate membrane positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Somatostatin R4/SSTR4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YATALKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SSTR4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Somatostatin R4/SSTR4 Protein (NBP2-39022PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Somatostatin R4/SSTR4 Antibody - BSA Free

• G-protein coupled receptor
• Somatostatin R4
• somatostatin receptor 4
• somatostatin receptor type 4
• SomatostatinR4
• SS4R
• SS-4-R
• SS4-R
• SSTR4

Background

SSTR4 has been reported to be expressed in brain, gastrointestinal tract, pancreas, and prostate tissues. No ESTs have been identified. G-protein Coupled Receptors (GPCRs) comprise one of the largest families of signaling molecules with more than a thousand members currently predicted to exist. All GPCRs share a structural motif consisting of seven membrane-spanning helices, and exist in both active and inactive forms. An array of activating ligands participate in the conformation of GPCRs which leads to signaling via G-proteins and downstream effectors. Ongoing studies have also shown the vast series of reactions which participate in the negative regulation of GPCRs. This "turn-off" activity has tremendous implications for the physiological action of the cell, and continues to drive pharmacological research for new drug candidates. Two blockbuster drugs which have been developed as GPCR-targeted pharmaceuticals are Zyprexa (Eli Lilly) and Claritin (Schering-Plough) which have multi-billion dollar shares of the mental health and allergy markets, respectively.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Somatostatin R4/SSTR4 Antibody (NBP2-39022)(1)

Publication using NBP2-39022

• Romiani A, Spetz J, Shubbar E Et al. Neuroblastoma xenograft models demonstrate the therapeutic potential of 177Lu-octreotate BMC cancer 2021-08-25 [PMID: 34433438] (IHC-P, Human)

Bioinformatics

• Gene Symbol: SSTR4
• Uniprot:
  • P31391(Human)