Soluble Liver/Pancreas Antigen Recombinant Protein Antigen

Images

 
There are currently no images for Soluble Liver/Pancreas Antigen Recombinant Protein Antigen (NBP2-57464PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Soluble Liver/Pancreas Antigen Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Soluble Liver/Pancreas Antigen.

Source: E. coli

Amino Acid Sequence: EKGKCPENGWDESTLELFLHELAIMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SEPSECS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57464.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Soluble Liver/Pancreas Antigen Recombinant Protein Antigen

  • EC 2.9.1.2
  • EC 2.9.1.n1
  • Liver-pancreas antigen
  • LPDKFZp434B1417
  • MGC161491
  • O-phosphoseryl-tRNA(Sec) selenium transferase
  • Sec synthase
  • Selenocysteine synthase
  • Selenocysteinyl-tRNA(Sec) synthase
  • Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase
  • SepSecS
  • Sep-tRNA:Sec-tRNA synthase
  • SLA/LP autoantigen
  • SLA/LP
  • SLA-p35
  • SLAUGA suppressor tRNA-associated protein
  • Soluble liver antigen
  • soluble liver antigen/liver pancreas antigen
  • tRNA(Ser/Sec)-associated antigenic protein
  • TRNP48

Background

The 21st amino acid, selenocysteine (sec), is distinct from other amino acids because it lacks its own tRNA synthetase and is the only amino acid synthesized on its cognate tRNA. Synthesis of sec begins with acylation of tRNA(sec) (TRSP; MIM 165060) by seryl-tRNA synthetase (SARS; MIM 607529) to give ser-tRNA(sec), which is subsequently phosphorylated by O-phosphoseryl-tRNA kinase (PSTK; MIM 611310) to give O-phosphoseryl-tRNA(sec). SEPSECS catalyzes the final step of sec synthesis by converting O-phosphoseryl-tRNA(sec) to selenocysteinyl-tRNA(sec) using selenophosphate as the selenium donor (Palioura et al., 2009 (PubMed 19608919)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
DHAPG0
Species: Hu
Applications: ELISA
NB300-917
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
DY1707
Species: Hu
Applications: ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NB200-527
Species: Hu, Mu, Rt
Applications: IP, WB
AF2009
Species: Hu
Applications: ICC, IHC
AF7895
Species: Hu
Applications: IHC, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP1-19773
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB

Publications for Soluble Liver/Pancreas Antigen Recombinant Protein Antigen (NBP2-57464PEP) (0)

There are no publications for Soluble Liver/Pancreas Antigen Recombinant Protein Antigen (NBP2-57464PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Soluble Liver/Pancreas Antigen Recombinant Protein Antigen (NBP2-57464PEP) (0)

There are no reviews for Soluble Liver/Pancreas Antigen Recombinant Protein Antigen (NBP2-57464PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Soluble Liver/Pancreas Antigen Recombinant Protein Antigen (NBP2-57464PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Soluble Liver/Pancreas Antigen Products

Research Areas for Soluble Liver/Pancreas Antigen Recombinant Protein Antigen (NBP2-57464PEP)

Find related products by research area.

Blogs on Soluble Liver/Pancreas Antigen

There are no specific blogs for Soluble Liver/Pancreas Antigen, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Soluble Liver/Pancreas Antigen Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SEPSECS