Recombinant Human SOCS-3 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human SOCS-3 Protein [H00009021-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SOCS-3 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-225 of Human SOCS3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
SOCS3
Purity
>10% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
50.49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00009021-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>10% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SOCS-3 GST (N-Term) Protein

  • ATOD4
  • CIS3
  • CIS3CIS-3
  • Cish3
  • cytokine-induced SH2 protein 3
  • Cytokine-inducible SH2 protein 3
  • SOCS3
  • SOCS-3
  • SOCS-3STAT-induced STAT inhibitor 3
  • SSI-3
  • SSI-3ATOD4
  • SSI3MGC71791
  • suppressor of cytokine signaling 3

Background

SOCS3( AAH60858, 1 a.a. - 226 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
7270-IL/CF
Species: Hu
NBP2-24463
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NB100-56637
Species: Hu, Mu
Applications: WB
NBP2-59451
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-75671
Species: Hu
Applications: WB, ICC/IF, IP
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow, KO
AF2168
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
NBP2-27406
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow

Publications for SOCS-3 Recombinant Protein (H00009021-P01)(1)

Reviews for SOCS-3 Recombinant Protein (H00009021-P01) (0)

There are no reviews for SOCS-3 Recombinant Protein (H00009021-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOCS-3 Recombinant Protein (H00009021-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional SOCS-3 Products

Array H00009021-P01

Bioinformatics Tool for SOCS-3 Recombinant Protein (H00009021-P01)

Discover related pathways, diseases and genes to SOCS-3 Recombinant Protein (H00009021-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOCS-3 Recombinant Protein (H00009021-P01)

Discover more about diseases related to SOCS-3 Recombinant Protein (H00009021-P01).
 

Pathways for SOCS-3 Recombinant Protein (H00009021-P01)

View related products by pathway.

PTMs for SOCS-3 Recombinant Protein (H00009021-P01)

Learn more about PTMs related to SOCS-3 Recombinant Protein (H00009021-P01).
 

Research Areas for SOCS-3 Recombinant Protein (H00009021-P01)

Find related products by research area.

Blogs on SOCS-3

There are no specific blogs for SOCS-3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SOCS-3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SOCS3