Recombinant Human SOCS-2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SOCS-2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-198 of Human SOCS2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SOCS2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00008835-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SOCS-2 Protein

  • CIS2
  • CIS2CIS-2
  • Cish2
  • Cytokine-inducible SH2 protein 2
  • SOCS2
  • SOCS-2
  • SOCS-2STAT-induced STAT inhibitor 2
  • SSI2
  • SSI-2STAT induced STAT inhibitor-2
  • SSI2STAT-induced STAT inhibitor-2
  • STATI2
  • STATI2suppressor of cytokine signaling-2
  • suppressor of cytokine signaling 2

Background

This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by a subset of cytokines, including erythropoietin, GM-CSF, IL10 and interferon (IFN)-gamma. The protein encoded by this gene is found to interact with the cytoplasmic domain of insulin-like growth factor-1 receptor (IGF1R), and thus is thought to be involved in the regulation of IGF1R mediated cell signaling. Knockout studies in mice also suggested a regulatory role of this gene in IGF-1 related growth control. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P
NB100-56637
Species: Hu, Mu
Applications: WB
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1360
Species: Mu
Applications: WB, IHC
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
MAB5808
Species: Hu
Applications: WB, ICC
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
MAB5628
Species: Hu, Mu
Applications: WB
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
H00008835-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SOCS-2 Recombinant Protein (H00008835-P01)(1)

Reviews for SOCS-2 Recombinant Protein (H00008835-P01) (0)

There are no reviews for SOCS-2 Recombinant Protein (H00008835-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOCS-2 Recombinant Protein (H00008835-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SOCS-2 Products

Bioinformatics Tool for SOCS-2 Recombinant Protein (H00008835-P01)

Discover related pathways, diseases and genes to SOCS-2 Recombinant Protein (H00008835-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOCS-2 Recombinant Protein (H00008835-P01)

Discover more about diseases related to SOCS-2 Recombinant Protein (H00008835-P01).
 

Pathways for SOCS-2 Recombinant Protein (H00008835-P01)

View related products by pathway.

PTMs for SOCS-2 Recombinant Protein (H00008835-P01)

Learn more about PTMs related to SOCS-2 Recombinant Protein (H00008835-P01).
 

Research Areas for SOCS-2 Recombinant Protein (H00008835-P01)

Find related products by research area.

Blogs on SOCS-2

There are no specific blogs for SOCS-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SOCS-2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SOCS2
Entrez