SNX7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SNX7 Antibody [NBP2-55435] - Staining of human cell line A-431 shows localization to nucleoli fibrillar center & cytosol.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNX7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IHILWSASEEDLVDTLKDVASCIDRCCKATEKRMSGLSEALLPVVHEYVLYSEMLMGVMKRRDQIQAELDSKVEV
Specificity
Specificity of human SNX7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNX7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SNX7 Recombinant Protein Antigen (NBP2-55435PEP)

Reactivity Notes

Mouse 87%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SNX7 Antibody

  • DKFZp564F052
  • MGC8717
  • sorting nexin 7
  • sorting nexin-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56141
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
H00005555-P01
Species: Hu
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-65033
Species: Hu
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005119-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-31442
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
H00201780-P01
Species: Hu
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24536
Species: Hu, Mu
Applications: WB
H00005352-B01P
Species: Hu, Rt
Applications: WB, ICC/IF

Publications for SNX7 Antibody (NBP2-55435) (0)

There are no publications for SNX7 Antibody (NBP2-55435).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNX7 Antibody (NBP2-55435) (0)

There are no reviews for SNX7 Antibody (NBP2-55435). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SNX7 Antibody (NBP2-55435) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SNX7 Antibody (NBP2-55435)

Discover related pathways, diseases and genes to SNX7 Antibody (NBP2-55435). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX7 Antibody (NBP2-55435)

Discover more about diseases related to SNX7 Antibody (NBP2-55435).
 

Pathways for SNX7 Antibody (NBP2-55435)

View related products by pathway.

Research Areas for SNX7 Antibody (NBP2-55435)

Find related products by research area.

Blogs on SNX7

There are no specific blogs for SNX7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNX7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX7