SNX7 Antibody - BSA Free

Immunohistochemistry-Paraffin: SNX7 Antibody [NBP1-86276] - Staining in human small intestine and tonsil tissues using anti-SNX7 antibody. Corresponding SNX7 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SNX7 Antibody [NBP1-86276] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SNX7 Antibody [NBP1-86276] - Staining of human tonsil shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SNX7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SNX7 Antibody - BSA Free (NBP1-86276) is a polyclonal antibody validated for use in IHC. Anti-SNX7 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IADHPTLTFNEDFKIFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSMRGVKNRPEEFMEMNNFIELFSQKINLIDKISQRIYKEE
• Predicted Species: Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNX7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SNX7 Protein (NBP1-86276PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SNX7 Antibody - BSA Free

• DKFZp564F052
• MGC8717
• sorting nexin 7
• sorting nexin-7

Background

SNX7 encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region like some family members, and its function is unknown. This gene results in two transcript variants encoding two distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SNX7 Antibody (NBP1-86276)(1)

Publication using NBP1-86276

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: SNX7