SNX7 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: SNX7 Antibody [NBP1-86276] - Staining in human small intestine and tonsil tissues using anti-SNX7 antibody. Corresponding SNX7 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: SNX7 Antibody [NBP1-86276] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SNX7 Antibody [NBP1-86276] - Staining of human tonsil shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SNX7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IADHPTLTFNEDFKIFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSMRGVKNRPEEFMEMNNFIELFSQKINLIDKISQRIYKEE
Specificity
Specificity of human SNX7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNX7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SNX7 Protein (NBP1-86276PEP)
Publications
Read Publication using NBP1-86276.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNX7 Antibody

  • DKFZp564F052
  • MGC8717
  • sorting nexin 7
  • sorting nexin-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00008837-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-45298
Species: Hu, Rt
Applications: WB, Flow, IHC, IHC-P, IF
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-93766
Species: Hu, Mu, Rt
Applications: WB, IHC
H00005119-B02P
Species: Hu
Applications: WB, ICC/IF
AF3926
Species: Hu, Mu, Rt
Applications: WB
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005352-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for SNX7 Antibody (NBP1-86276)(1)

Reviews for SNX7 Antibody (NBP1-86276) (0)

There are no reviews for SNX7 Antibody (NBP1-86276). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SNX7 Antibody (NBP1-86276) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SNX7 Products

Bioinformatics Tool for SNX7 Antibody (NBP1-86276)

Discover related pathways, diseases and genes to SNX7 Antibody (NBP1-86276). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX7 Antibody (NBP1-86276)

Discover more about diseases related to SNX7 Antibody (NBP1-86276).
 

Pathways for SNX7 Antibody (NBP1-86276)

View related products by pathway.

Research Areas for SNX7 Antibody (NBP1-86276)

Find related products by research area.

Blogs on SNX7

There are no specific blogs for SNX7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNX7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX7