SNW1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SNW1 Antibody [NBP1-88524] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell line PC-3.

Western Blot: SNW1 Antibody [NBP1-88524] - Analysis using Anti-SNW1 antibody NBP1-88524 (A) shows similar pattern to independent antibody NBP1-88523 (B).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SNW1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SNW1 Antibody - BSA Free (NBP1-88524) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNW1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 61.5 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  SNW1 Protein (NBP1-88524PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SNW1 Antibody - BSA Free

• Bx42
• homolog of Drosophila BX42
• MGC119379
• NCoA-62
• Nuclear protein SkiP
• Nuclear receptor coactivator NCoA-62
• nuclear receptor coactivator, 62-kD
• Prp45
• PRPF45
• SKI interacting protein
• Ski-interacting protein
• SKIPSKIIP
• SNW domain containing 1
• SNW domain-containing protein 1

Background

SNW1, a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also function as a splicing factor by interacting with poly(A)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of SKI oncoproteins that is required for transforming activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNW1
• Entrez:
  • 22938(Human)
  • 66354(Mouse)
• Uniprot:
  • Q13573(Human)