SNRPG Antibody (2H8-1C12) - Azide and BSA Free

Western Blot: SNRPG Antibody (2H8-1C12) [H00006637-M01] - SNRPG monoclonal antibody (M01), clone 2H8-1C12 Analysis of SNRPG expression in Hela S3 NE.

Western Blot: SNRPG Antibody (2H8-1C12) [H00006637-M01] - Analysis of SNRPG expression in transfected 293T cell line by SNRPG monoclonal antibody (M01), clone 2H8-1C12.Lane 1: SNRPG transfected lysate(8.5 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2H8-1C12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SNRPG Antibody (2H8-1C12) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SNRPG (AAH00070, 1 a.a. ~ 76 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV
• Specificity: SNRPG - small nuclear ribonucleoprotein polypeptide G
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SNRPG
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SNRPG Antibody (2H8-1C12) - Azide and BSA Free

• MGC117317
• PBSCG
• small nuclear ribonucleoprotein G
• small nuclear ribonucleoprotein polypeptide G
• SMG
• Sm-GSm protein G
• snRNP-G

Background

Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNRPG
• Entrez:
  • 6637(Human)
• OMIM:
  • 603542(Human)
• Uniprot:
  • AAH00070(Human)