SNRPA1 Antibody

Western Blot: SNRPA1 Antibody [NBP1-57239] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml

Immunohistochemistry-Paraffin: SNRPA1 Antibody [NBP1-57239] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Discontinued

SNRPA1 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SNRPA1 (small nuclear ribonucleoprotein polypeptide A') The peptide sequence was selected from the C terminal of SNRPA1. Peptide sequence RRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNRPA1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Alternate Names for SNRPA1 Antibody

• Lea1
• small nuclear ribonucleoprotein polypeptide A'
• U2 small nuclear ribonucleoprotein A'
• U2 small nuclear ribonucleoprotein polypeptide A'
• U2 snRNP A'

Background

SNRPA1 contains 3 LRR (leucine-rich) repeats and belongs to the U2 small nuclear ribonucleoprotein A family. It is associated with sn-RNP U2 and helps the A' protein to bind stem loop IV of U2 snRNA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNRPA1