Recombinant Human SNF5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SNF5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 81-180 of Human SMARCB1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SMARCB1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SNF5 Protein

  • BAF47
  • BAF47hSNF5
  • BRG1-associated factor 47
  • hSNFS
  • Ini1
  • INI1RTPS1
  • Integrase interactor 1 protein
  • malignant rhabdoid tumor suppressor
  • RDTSNF5 homolog
  • Sfh1p
  • SNF5
  • SNF5L1
  • Snr1
  • subfamily b, member 1
  • sucrose nonfermenting, yeast, homolog-like 1
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily B member 1

Background

SMARCB1 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20415
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
H00000072-D01P
Species: Hu
Applications: WB

Publications for SNF5 Partial Recombinant Protein (H00006598-Q01) (0)

There are no publications for SNF5 Partial Recombinant Protein (H00006598-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNF5 Partial Recombinant Protein (H00006598-Q01) (0)

There are no reviews for SNF5 Partial Recombinant Protein (H00006598-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNF5 Partial Recombinant Protein (H00006598-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SNF5 Products

Bioinformatics Tool for SNF5 Partial Recombinant Protein (H00006598-Q01)

Discover related pathways, diseases and genes to SNF5 Partial Recombinant Protein (H00006598-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNF5 Partial Recombinant Protein (H00006598-Q01)

Discover more about diseases related to SNF5 Partial Recombinant Protein (H00006598-Q01).
 

Pathways for SNF5 Partial Recombinant Protein (H00006598-Q01)

View related products by pathway.

PTMs for SNF5 Partial Recombinant Protein (H00006598-Q01)

Learn more about PTMs related to SNF5 Partial Recombinant Protein (H00006598-Q01).
 

Research Areas for SNF5 Partial Recombinant Protein (H00006598-Q01)

Find related products by research area.

Blogs on SNF5.

You can't be without me - SNF5
The protein encoded by SNF5 is a component of the chromatin-remodeling protein complex responsible for relieving repressive chromatin structures by allowing the transcriptional machinery to access targets more effectively. SNF5 has been found to be a...  Read full blog post.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141
SNF5 Antibody (3E10.)
H00006598-M01
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SNF5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCB1