SNF5 Antibody (3E10)

Images

 
Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10. Analysis of SMARCB1 expression in Raw 264.7.
Immunohistochemistry-Paraffin: SNF5 Antibody (3E10) [H00006598-M01] - Analysis of monoclonal antibody to SMARCB1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10 Analysis of SMARCB1 expression in PC-12.
Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10. Analysis of SMARCB1 expression in Hela S3 NE.
Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10. Analysis of SMARCB1 expression in NIH/3T3.
ELISA: SNF5 Antibody (3E10) [H00006598-M01] - Detection limit for recombinant GST tagged SMARCB1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
3E10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SNF5 Antibody (3E10) Summary

Immunogen
SMARCB1 (NP_003064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA
Specificity
SMARCB1 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMARCB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publication using H00006598-M01.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SNF5 Antibody (3E10)

  • BAF47
  • BAF47hSNF5
  • BRG1-associated factor 47
  • hSNFS
  • Ini1
  • INI1RTPS1
  • Integrase interactor 1 protein
  • malignant rhabdoid tumor suppressor
  • RDTSNF5 homolog
  • Sfh1p
  • SNF5
  • SNF5L1
  • Snr1
  • subfamily b, member 1
  • sucrose nonfermenting, yeast, homolog-like 1
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily B member 1

Background

The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61879
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20415
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24695
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP1-90295
Species: Hu
Applications: WB, IHC, IHC-P
NB600-533
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IP
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for SNF5 Antibody (H00006598-M01)(1)


Reviews for SNF5 Antibody (H00006598-M01) (0)

There are no reviews for SNF5 Antibody (H00006598-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SNF5 Antibody (H00006598-M01). (Showing 1 - 1 of 1 FAQ).

  1. Can I use this antibody with paraffin wax embedded tissue of meningioma for Immunohistochemistry?
    • H00006598-M01 has been tested and validated for use in IHC-Paraffin in the following species: human, rat and mouse. The IHC image you can see on the datasheet is of human testis. The ability to detect the protein in the tumor tissues you are studying really depends on the tumor biology. We do guarantee the antibody in human and would highly recommend using a positive control of normal tissue in your staining.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SNF5 Products

Bioinformatics Tool for SNF5 Antibody (H00006598-M01)

Discover related pathways, diseases and genes to SNF5 Antibody (H00006598-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNF5 Antibody (H00006598-M01)

Discover more about diseases related to SNF5 Antibody (H00006598-M01).
 

Pathways for SNF5 Antibody (H00006598-M01)

View related products by pathway.

PTMs for SNF5 Antibody (H00006598-M01)

Learn more about PTMs related to SNF5 Antibody (H00006598-M01).
 

Research Areas for SNF5 Antibody (H00006598-M01)

Find related products by research area.

Blogs on SNF5.

You can't be without me - SNF5
The protein encoded by SNF5 is a component of the chromatin-remodeling protein complex responsible for relieving repressive chromatin structures by allowing the transcriptional machinery to access targets more effectively. SNF5 has been found to be a...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNF5 Antibody (3E10) and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCB1
Entrez
OMIM
Uniprot