Home » SNF5 » SNF5 Antibodies » SNF5 Antibody (3E10)

SNF5 Antibody (3E10)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10. Analysis of SMARCB1 expression in Raw 264.7.
Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10. Analysis of SMARCB1 expression in Raw 264.7.
Immunohistochemistry-Paraffin: SNF5 Antibody (3E10) [H00006598-M01] - Analysis of monoclonal antibody to SMARCB1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10 Analysis of SMARCB1 expression in PC-12.
Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10. Analysis of SMARCB1 expression in Hela S3 NE.
Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10. Analysis of SMARCB1 expression in NIH/3T3.
ELISA: SNF5 Antibody (3E10) [H00006598-M01] - Detection limit for recombinant GST tagged SMARCB1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
3E10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SNF5 Antibody (3E10) Summary

Immunogen
SMARCB1 (NP_003064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA
Specificity
SMARCB1 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMARCB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publication using H00006598-M01.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SNF5 Antibody (3E10)

  • BAF47
  • BAF47hSNF5
  • BRG1-associated factor 47
  • hSNFS
  • Ini1
  • INI1RTPS1
  • Integrase interactor 1 protein
  • malignant rhabdoid tumor suppressor
  • RDTSNF5 homolog
  • Sfh1p
  • SNF5
  • SNF5L1
  • Snr1
  • subfamily b, member 1
  • sucrose nonfermenting, yeast, homolog-like 1
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily B member 1

Background

The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SMARCA1 Antibody
(2H7B8) - BSA Free
NBP2-61879
ELISA: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Black line: Control Antigen (100 ng);Purple line: Antigen (10ng); Blue line: Antigen (50 ng); Red line:Antigen (100 ng)
Flow Cytometry: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Analysis of NIH/3T3 cells using SMARCA1 mouse mAb (green) and negative control (red).
Immunohistochemistry: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Analysis of paraffin-embedded esophageal cancer tissues using SMARCA1 mouse mAb with DAB staining.
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
Brg1 Antibody
[Unconjugated]
AF5738
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and K562 human chronic myelogenous leukemia cell line, cytoplasmic and nuclear extracts. PVDF membrane was probed with 2 µg/mL Goat Anti-Human Brg1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5738) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band for Brg1 was detected at approximately 205 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Brg1 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Goat Anti-Human Brg1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5738) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Brg1 was detected in immersion fixed undifferentiated rat cortical stem cells using Goat Anti-Human Brg1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5738) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
Species: Hu
Applications: ICC, KO, WB
BRM Antibody
NBP3-13283
Immunohistochemistry-Paraffin: BRM Antibody [NBP3-13283] - BRM antibody detects BRM protein at nucleus in mouse brain by immunohistochemical analysis. Sample: Paraffin-embedded mouse brain. BRM antibody (NBP3-13283) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunohistochemistry-Paraffin: BRM Antibody [NBP3-13283] - BRM antibody detects BRM protein at nucleus in mouse testis by immunohistochemical analysis. Sample: Paraffin-embedded mouse testis. BRM antibody (NBP3-13283) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunocytochemistry/Immunofluorescence: BRM Antibody [NBP3-13283] - BRM antibody detects BRM protein at nucleus by immunofluorescent analysis. Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: BRM stained by BRM antibody (NBP3-13283) diluted at 1:500. Red: phalloidin, a cytoskeleton marker, diluted at 1:200. Scale bar= 10 um.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
POMT1 Antibody
NBP3-12487
Immunohistochemistry-Paraffin: POMT1 Antibody [NBP3-12487] - 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 40x magnification.
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(46 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
SMARCC1 Antibody
NBP2-20415
Western Blot: SMARCC1 Antibody [NBP2-20415] - Various whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with SMARCC1 antibody diluted at 1:2000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: SMARCC1 Antibody [NBP2-20415] - Wild-type (WT) and SMARCC1 knockout (KO) HeLa cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with SMARCC1 antibody diluted at 1:5000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Paraffin: SMARCC1 Antibody [NBP2-20415] - Immunohistochemical analysis of paraffin-embedded BT483 xenograft, using antibody at 1:500 dilution.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Immunohistochemistry-Frozen: Vimentin Antibody [NB300-223] - 10 um Cryosections from PFA fixed murine brain acute slices stained with Vimentin antibody (1:600) and Alexa Fluor 488 anti chicken IgG. Antibody showed specific staining, also of blood vessels. IHC-Fr image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Human A7 cells. Cells were fixed with 10% formalin and permeabilized with 0.1% TritonX-100. After blocking, cells were incubated with primary antibody (1:600) at 4C O/N followed with Alexa Fluor 488 labeled secondary antibody and counterstained with DAPI and Phalloidin for nuclei and F-actin respectively. Imaged with Leica TCS SP5 confocal microscope. ICC/IF image submitted by a verified customer review.
(6 Reviews)
(55 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(34 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(16 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot: Cyclin D1 Antibody (SPM587) [NBP2-32840] - HELLS expression and protein levels are modulated with YAP1/TEAD inhibition downstream of SHH signaling. Western blot showing protein levels of HELLS, cleaved caspase 3 (CC3), and Cyclin D1 in verteporfin treated CGNPs. Blot is representative of three replicates. Full-length blots are presented in Supplementary Fig. S4. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-50088-1), licensed under a CC-BY licence.
Flow Cytometry: Cyclin D1 Antibody (SPM587) [NBP2-32840] - Flow Cytometric analysis of human Cyclin D1 on Jurkat cells. Black: cells alone; Green: Isotype Control; Red: PE-labeled Cyclin D1 Monoclonal Antibody (SPM587).
Flow Cytometry: Cyclin D1 Antibody (SPM587) [NBP2-32840] - Flow Cytometric analysis of human Cyclin D1 on MCF-7 cells. Black: cells alone; Green: Isotype Control; Red: PE-labeled Cyclin D1 Monoclonal Antibody (SPM587).
(1 Review)
(8 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NF2/Merlin Antibody
NBP1-87757
Immunocytochemistry/Immunofluorescence: NF2/Merlin Antibody [NBP1-87757] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
GFAP Antibody
NB300-141
Immunohistochemistry: GFAP Antibody [NB300-141] - Analysis of a rat cerebellum section stained with rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green and mouse monoclonal antibody to MeCP2, dilution 1:500, in red. The blue is DAPI staining of nuclear DNA. Following transcardial perfusion of rat with 4% paraformaldehyde, brain was post fixed for 1 hour, cut to 45 uM, and free-floating sections were stained with above antibodies. The GFAP antibody stains the network of astrocytic cells and the processes of Bergmann glia in the molecular layer. The MeCP2 antibody specifically labels nuclei of certain neurons.
Western Blot: GFAP Antibody [NB300-141] - Analysis of different tissue lysates using rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord. Strong band at about 50 kDa corresponds to the major isotype of the GFAP protein. Smaller isotypes and proteolytic fragments of GFAP are also detected on the blot.
Western Blot: GFAP Antibody [NB300-141] - Analysis of Rat brain lysate. Antibody at 1:5000. Specific band running with an apparent SDS-PAGE molecular weight of ~50 kDa corresponds to rodent GFAP was observed.
(12 Reviews)
(83 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MUC1 Antibody
(SM3) - BSA Free
NB120-22711
Immunocytochemistry/Immunofluorescence: MUC-1 Antibody (SM3) [NB120-22711] - MCF7 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-MUC1 [SM3] at 5 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: MUC1 Antibody (SM3) - BSA Free [NB120-22711] - An intracellular stain was performed on MCF7 cells with MUC1 Antibody (SM3) NB120-22711AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
Immunocytochemistry/Immunofluorescence: MUC-1 Antibody (SM3) [NB120-22711] - MUC-1 antibody was tested in MCF7 cells at 10 ug/ml using a Dylight 488 conjugated secondary antibody (Green). Actin (Red) and DNA (Blue) were counterstained using Phalloidin 568 and DAPI.
(11 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
RB1 Antibody
(172C1094) - (cleaved
NB100-56598
Knockdown Validated: RB1 Antibody (172C1094) - (cleaved) [NB100-56598] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and RB-1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2 ug/ml of Mouse Anti-Human RB-1 Monoclonal Antibody (Catalog # NB100-56598) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for RB-1 at approximately 60 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunohistochemistry: cleaved Retinoblastoma 1 Antibody (172C1094) [NB100-56598] - Analysis in sections of primary human breast tumors. Image courtesy of Dr. Macleod, The Ben May Institute for Cancer Research, and The University of Chicago.
Western Blot: cleaved Retinoblastoma 1 Antibody (172C1094) [NB100-56598] - Analysis in HL60 cells were treated with camptothecin for 24 hours.
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
Serpin A3/alpha
1-Antichymotrypsin An ...
NBP2-52559
Western Blot: Serpin A3/alpha 1-Antichymotrypsin Antibody (5G3C11) [NBP2-52559] - Analysis using SERPIN A3 mouse mAb against A549 cell lysate.
ELISA: Serpin A3/alpha 1-Antichymotrypsin Antibody (5G3C11) [NBP2-52559] - Black line: Control Antigen (100 ng); Purple line: Antigen(10ng); Blue line: Antigen (50 ng); Red line: Antigen (100 ng).
Flow Cytometry: Serpin A3/alpha 1-Antichymotrypsin Antibody (5G3C11) [NBP2-52559] - Analysis of A549 cells using SERPINA3 mouse mAb (green) and negative control (red).
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Actin Gamma 1
Antibody
NB600-533
Western Blot: Actin Gamma 1 Antibody [NB600-533] - Detection of human and mouse Cytoskeletal Actin by western blot. Samples: Whole cell lysate (15 ug) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Cytoskeletal Actin antibody NB600-533 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Western Blot: Actin Gamma 1 Antibody [NB600-533] - Whole cell lysate from HeLa (1, 2.5, 5, 15 and 50 ug) and mouse NIH3T3 cells (50 ug), probed with diluted at 0.04 ug/ml.
Western Blot: Actin Gamma 1 Antibody [NB600-533] - Knockdown of DLK in differentiated Neuro-2a cells. Neuro-2a cells were infected with an empty lentiviral vector (pLKO.1) or with lentivirus expressing mouse DLK shRNAs (sh73 and sh69). After infection and selection with puromycin, cells were subjected to differentiation for 24 h before being processed for total RNA extraction and whole-cell extracts. Representative Western blots showing levels of DLK, phospho-JNK (p-JNK), total JNK, phospho-c-Jun (p-c-Jun) and actin in infected Neuro-2a cells. Image collected and cropped by CiteAb from the following publication (http://neuraldevelopment.biomedcentral.com/articles/10.1186/s13064-016-0068-8), licensed under a CC-BY licence.
(6 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
actin, gamma 2
Antibody
H00000072-D01P
Western Blot: actin, gamma 2 Antibody [H00000072-D01P] - Analysis of ACTG2 expression in transfected 293T cell line by ACTG2 polyclonal antibody.Lane 1: ACTG2 transfected lysate(41.90 KDa).Lane 2: Non-transfected lysate.
(1 Publication)
Species: Hu
Applications: WB
SNF5 Antibody
(3E10)
H00006598-M01
SNF5 Antibody (3E10)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for SNF5 Antibody (H00006598-M01)(1)


Reviews for SNF5 Antibody (H00006598-M01) (0)

There are no reviews for SNF5 Antibody (H00006598-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SNF5 Antibody (H00006598-M01). (Showing 1 - 1 of 1 FAQ).

  1. Can I use this antibody with paraffin wax embedded tissue of meningioma for Immunohistochemistry?
    • H00006598-M01 has been tested and validated for use in IHC-Paraffin in the following species: human, rat and mouse. The IHC image you can see on the datasheet is of human testis. The ability to detect the protein in the tumor tissues you are studying really depends on the tumor biology. We do guarantee the antibody in human and would highly recommend using a positive control of normal tissue in your staining.

Secondary Antibodies

 

Isotype Controls

Additional SNF5 Products

Bioinformatics Tool for SNF5 Antibody (H00006598-M01)

Discover related pathways, diseases and genes to SNF5 Antibody (H00006598-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNF5 Antibody (H00006598-M01)

Discover more about diseases related to SNF5 Antibody (H00006598-M01).
 

Pathways for SNF5 Antibody (H00006598-M01)

View related products by pathway.

PTMs for SNF5 Antibody (H00006598-M01)

Learn more about PTMs related to SNF5 Antibody (H00006598-M01).
 

Research Areas for SNF5 Antibody (H00006598-M01)

Find related products by research area.

Blogs on SNF5.

Check out the latest blog posts on SNF5.
You can't be without me - SNF5
The protein encoded by SNF5 is a component of the chromatin-remodeling protein complex responsible for relieving repressive chromatin structures by allowing the transcriptional machinery to access targets more effectively. SNF5 has been found to be a ...  Read full blog post.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNF5 Antibody (3E10) and receive a gift card or discount.


Bioinformatics

Gene Symbol SMARCB1
Entrez
OMIM
Uniprot