Recombinant Human SMYD2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SMYD2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-433 of Human SMYD2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SMYD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
76.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SMYD2 Protein

  • EC 2.1.1.43
  • Histone methyltransferase SMYD2
  • HSKM-Bzinc finger, MYND domain containing 14
  • KMT3CEC 2.1.1.-
  • Lysine N-methyltransferase 3C
  • MGC119305
  • SET and MYND domain containing 2
  • SET and MYND domain-containing protein 2
  • ZMYND14

Background

SET domain-containing proteins, such as SMYD2, catalyze lysine methylation (Brown et al., 2006 [PubMed 16805913]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-1762
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NB100-56664
Species: Hu, Mu
Applications: WB, ChIP, IHC-P
NBP2-20428
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20430
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IP, ChIP
NBP1-91269
Species: Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
NBP1-89113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13948
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB200-342
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-67074
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-23869
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF
NB500-101
Species: Hu, Bv
Applications: WB, Flow, ICC/IF, IP
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, KO
NB100-81657
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP

Publications for SMYD2 Recombinant Protein (H00056950-P01) (0)

There are no publications for SMYD2 Recombinant Protein (H00056950-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMYD2 Recombinant Protein (H00056950-P01) (0)

There are no reviews for SMYD2 Recombinant Protein (H00056950-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMYD2 Recombinant Protein (H00056950-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SMYD2 Recombinant Protein (H00056950-P01)

Discover related pathways, diseases and genes to SMYD2 Recombinant Protein (H00056950-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMYD2 Recombinant Protein (H00056950-P01)

Discover more about diseases related to SMYD2 Recombinant Protein (H00056950-P01).
 

Pathways for SMYD2 Recombinant Protein (H00056950-P01)

View related products by pathway.

PTMs for SMYD2 Recombinant Protein (H00056950-P01)

Learn more about PTMs related to SMYD2 Recombinant Protein (H00056950-P01).

Blogs on SMYD2

There are no specific blogs for SMYD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

53BP1 Antibody
NB100-304
SMYD2 Antibody
NBP1-83186
CENPF Antibody
NB500-101

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SMYD2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMYD2