SMUG1 Antibody

Images

 
Western Blot: SMUG1 Antibody [NBP1-52981] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMUG1 Antibody Summary

Immunogen
Synthetic peptides corresponding to SMUG1(single-strand-selective monofunctional uracil-DNA glycosylase 1) The peptide sequence was selected from the middle region of SMUG1. Peptide sequence IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMUG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SMUG1 and was validated on Western blot.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SMUG1 Antibody

  • EC 3.2.2
  • EC 3.2.2.-
  • FDG
  • HMUDG
  • MGC104370
  • single-strand selective monofunctional uracil DNA glycosylase
  • single-strand-selective monofunctional uracil-DNA glycosylase 1
  • UNG3

Background

SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC-P
AF321
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB100-64650
Species: Hu, Mu, Rt, Po, GP, Ze
Applications: IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-80841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB41281
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-38464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4478
Species: Hu
Applications: WB, IHC
H00005670-Q01
Species: Hu
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SMUG1 Antibody (NBP1-52981) (0)

There are no publications for SMUG1 Antibody (NBP1-52981).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMUG1 Antibody (NBP1-52981) (0)

There are no reviews for SMUG1 Antibody (NBP1-52981). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMUG1 Antibody (NBP1-52981). (Showing 1 - 1 of 1 FAQ).

  1. What is the lysis buffer used for the WB of SMUG1?
    • In the WB validation testing of NBP1-52981, the lysis buffer used for generating test samples was follows: Cell Lysis Buffer (1% NP40, 0.5% DOC, 1mM EDTA, 65mM Tri s-HCl pH=6.4, 1mM PMSF, 1ug/ml Apoprotin, 1ug/ml L e upeptin, 1ug/ml Pepstatin).

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SMUG1 Antibody (NBP1-52981)

Discover related pathways, diseases and genes to SMUG1 Antibody (NBP1-52981). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMUG1 Antibody (NBP1-52981)

Discover more about diseases related to SMUG1 Antibody (NBP1-52981).
 

Pathways for SMUG1 Antibody (NBP1-52981)

View related products by pathway.

PTMs for SMUG1 Antibody (NBP1-52981)

Learn more about PTMs related to SMUG1 Antibody (NBP1-52981).
 

Research Areas for SMUG1 Antibody (NBP1-52981)

Find related products by research area.

Blogs on SMUG1

There are no specific blogs for SMUG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMUG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMUG1
Uniprot