SMPD1 Antibody

Images

 
Western Blot: SMPD1 Antibody [NBP1-69267] - This Anti-SMPD1 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMPD1 Antibody Summary

Immunogen
Synthetic peptides corresponding to SMPD1(sphingomyelin phosphodiesterase 1, acid lysosomal) The peptide sequence was selected from the middle region of SMPD1. Peptide sequence INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV.
Specificity
Not suggested for use with mouse.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMPD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SMPD1 and was validated on Western blot.
Theoretical MW
65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SMPD1 Antibody

  • Acid sphingomyelinase
  • aSMase
  • ASMsphingomyelin phosphodiesterase
  • EC 3.1.4.12
  • NPD
  • SMPD1
  • sphingomyelin phosphodiesterase 1, acid lysosomal

Background

SMPD1 is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87810
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
MAB7184
Species: Hu
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC

Publications for SMPD1 Antibody (NBP1-69267) (0)

There are no publications for SMPD1 Antibody (NBP1-69267).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMPD1 Antibody (NBP1-69267) (0)

There are no reviews for SMPD1 Antibody (NBP1-69267). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMPD1 Antibody (NBP1-69267) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMPD1 Products

Bioinformatics Tool for SMPD1 Antibody (NBP1-69267)

Discover related pathways, diseases and genes to SMPD1 Antibody (NBP1-69267). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMPD1 Antibody (NBP1-69267)

Discover more about diseases related to SMPD1 Antibody (NBP1-69267).
 

Pathways for SMPD1 Antibody (NBP1-69267)

View related products by pathway.

PTMs for SMPD1 Antibody (NBP1-69267)

Learn more about PTMs related to SMPD1 Antibody (NBP1-69267).
 

Research Areas for SMPD1 Antibody (NBP1-69267)

Find related products by research area.

Blogs on SMPD1

There are no specific blogs for SMPD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMPD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMPD1
Entrez