SMCP Antibody (4F4)

Images

 
Sandwich ELISA: SMCP Antibody (4F4) [H00004184-M04] - Detection limit for recombinant GST tagged SMCP is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SMCP Antibody (4F4) Summary

Immunogen
SMCP (AAH14593, 1 a.a. - 116 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK
Specificity
SMCP - sperm mitochondria-associated cysteine-rich protein (4F4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMCP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SMCP Antibody (4F4)

  • HSMCSGEN1
  • MCSMGC26305
  • MCSPMGC26519
  • mitochondrial capsule selenoprotein
  • sperm mitochondria-associated cysteine-rich protein
  • sperm mitochondrial-associated cysteine-rich protein

Background

Sperm mitochondria differ in morphology and subcellular localization from those of somatic cells. They are elongated, flattened, and arranged circumferentially to form a helical coiled sheath in the midpiece of the sperm flagellum. The protein encoded by this gene localizes to the capsule associated with the mitochondrial outer membranes and is thought to function in the organization and stabilization of the helical structure of the sperm's mitochondrial sheath. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14243
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-86241
Species: Hu
Applications: WB, IHC, IHC-P
AF5539
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-49579
Species: Hu
Applications: IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
H00004184-M04
Species: Hu
Applications: WB, ELISA

Publications for SMCP Antibody (H00004184-M04) (0)

There are no publications for SMCP Antibody (H00004184-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMCP Antibody (H00004184-M04) (0)

There are no reviews for SMCP Antibody (H00004184-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMCP Antibody (H00004184-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMCP Products

Bioinformatics Tool for SMCP Antibody (H00004184-M04)

Discover related pathways, diseases and genes to SMCP Antibody (H00004184-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMCP Antibody (H00004184-M04)

Discover more about diseases related to SMCP Antibody (H00004184-M04).
 

Pathways for SMCP Antibody (H00004184-M04)

View related products by pathway.

PTMs for SMCP Antibody (H00004184-M04)

Learn more about PTMs related to SMCP Antibody (H00004184-M04).

Blogs on SMCP

There are no specific blogs for SMCP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMCP Antibody (4F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol SMCP
Entrez
Uniprot