SMC5 Antibody

Immunohistochemistry-Paraffin: SMC5 Antibody [NBP2-47271] - Analysis in human testis and skeletal muscle tissues. Corresponding SMC5 RNA-seq data are presented for the same tissues.

Western Blot: SMC5 Antibody [NBP2-47271] - Analysis in human cell line MOLT-4.

Immunocytochemistry/Immunofluorescence: SMC5 Antibody [NBP2-47271] - Staining of human cell line HeLa shows localization to nuclear speckles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SMC5 Antibody [NBP2-47271] - Staining of human testis shows moderate nuclear speckles positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: SMC5 Antibody [NBP2-47271] - Staining of human endometrium shows weak nuclear speckles positivity in glandular cells.

Immunohistochemistry-Paraffin: SMC5 Antibody [NBP2-47271] - Staining of human prostate shows moderate nuclear speckles positivity in glandular cells.

Immunohistochemistry-Paraffin: SMC5 Antibody [NBP2-47271] - Staining of human skeletal muscle shows low positivity in myocytes.

Product Discontinued

SMC5 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EVPSKRKNSAPQLPLLQSSGPFVEGSIVRISMENFLTYDICEVSPGPHLNMIVGANGTGKSSIVCAICLGLAGKPAFMGRADKVGFFVKRGCSRGMVEIELFRASGNLVITR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMC5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SMC5 Antibody

• hSMC5
• KIAA0594SMC5 structural maintenance of chromosomes 5-like 1 (yeast)
• SMC protein 5
• SMC-5
• SMC5L1SMC5 structural maintenance of chromosomes 5-like 1
• structural maintenance of chromosomes 5
• structural maintenance of chromosomes protein 5

Background

SMC (Structural maintenance of chromosomes) proteins are members of multisubunit complexes that play a critical role in chromosome organization, segregation, gene regulation, and DNA repair. Two of these complexes, cohesin and condensin consist of a core complex of an SMC1 and SMC3 heterodimer or an SMC2 and SMC4 heterodimer, respectively. A third complex includes a heterodimer of SMC5 and SMC6 whose function is not fully understood but is proposed to be related to DNA repair.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMC5