SMC5 Antibody

Images

 
Western Blot: SMC5 Antibody [NBP2-47271] - Analysis in human cell line MOLT-4.
Immunocytochemistry/ Immunofluorescence: SMC5 Antibody [NBP2-47271] - Staining of human cell line HeLa shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SMC5 Antibody [NBP2-47271] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SMC5 Antibody [NBP2-47271] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SMC5 Antibody [NBP2-47271] - Staining in human testis and skeletal muscle tissues using anti-SMC5 antibody. Corresponding SMC5 RNA-seq data are presented for ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SMC5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EVPSKRKNSAPQLPLLQSSGPFVEGSIVRISMENFLTYDICEVSPGPHLNMIVGANGTGKSSIVCAICLGLAGKPAFMGRADKVGFFVKRGCSRGMVEIELFRASGNLVITR
Specificity
Specificity of human SMC5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SMC5 Protein (NBP2-47271PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SMC5 Antibody

  • hSMC5
  • KIAA0594SMC5 structural maintenance of chromosomes 5-like 1 (yeast)
  • SMC protein 5
  • SMC-5
  • SMC5L1SMC5 structural maintenance of chromosomes 5-like 1
  • structural maintenance of chromosomes 5
  • structural maintenance of chromosomes protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00079677-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-02956
Species: Hu
Applications: WB, Flow, ICC/IF
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF1626
Species: Hu
Applications: WB, ICC
NBP2-14006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92200
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00056160-Q01
Species: Hu
NB100-207
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-204
Species: Hu, Mu, Xp
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
H00084901-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-373
Species: Hu
Applications: WB, ICC/IF, IP, ICC
NBP2-55368
Species: Hu
Applications: ICC/IF
NBP2-03263
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-58116
Species: Hu
Applications: ICC/IF
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-98864
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-47271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SMC5 Antibody (NBP2-47271) (0)

There are no publications for SMC5 Antibody (NBP2-47271).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMC5 Antibody (NBP2-47271) (0)

There are no reviews for SMC5 Antibody (NBP2-47271). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMC5 Antibody (NBP2-47271) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SMC5 Antibody (NBP2-47271)

Discover related pathways, diseases and genes to SMC5 Antibody (NBP2-47271). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMC5 Antibody (NBP2-47271)

Discover more about diseases related to SMC5 Antibody (NBP2-47271).
 

Pathways for SMC5 Antibody (NBP2-47271)

View related products by pathway.

PTMs for SMC5 Antibody (NBP2-47271)

Learn more about PTMs related to SMC5 Antibody (NBP2-47271).
 

Research Areas for SMC5 Antibody (NBP2-47271)

Find related products by research area.

Blogs on SMC5

There are no specific blogs for SMC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMC5